Entry information : VdaCIIAA03
Entry ID 6830
Creation 2009-05-22 (Christophe Dunand)
Last sequence changes 2017-05-22 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-22 (Catherine Mathe)
Peroxidase information: VdaCIIAA03
Name VdaCIIAA03
Class Asco Class II type A    [Orthogroup: CIIAA003]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Verticillium
Organism Verticillium dahliae    [TaxId: 27337 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VdaCIIAA03
start..stop
S start..stop
VaaCIIAA03 494 2e-177 1..351 1..358
CgloCIIAA04_ST23 305 2e-100 1..352 1..364
MEspCIIAA02_NRRL54901 301 2e-100 1..351 1..358
ClunCIIAA01 297 5e-99 3..352 7..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 782438..783406 969 N° 2 782277..782366 90  
complement(join(782277..782366,782438..783406))


exon

Literature and cross-references VdaCIIAA03
DNA ref. JGI genome:   Supercontig_1.13 (783349..782277)
Protein sequence: VdaCIIAA03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352
PWM (Da):   %s   39108.99  
PI (pH):   %s   5.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFAYVFAALAVPIYAHPSMTNLVNELMSRQADDSTLENDDIAADLHKVSDSSLTSVGQEIRDLLARKGNPQTTEHYGSVPDLGSDKCQKDTCCVWSYIGKEMRDTFLNPDDSCNRFARQMVRLGFHDCITHAGRGKGGCDGSIVNSNDENARVENKGMQEITSKLKQWFNKYEKYGITMADLIQFGASVAVHTCPGGPSCKVFMGRQDTNDANPSGLVPTPFDTAEQLIQKFKAKSLDEQSLASLLGSHTISQQFVVDPKRAGDPQDSTPTKWDQKYYVQTLDQSKAPSNVFSFASDINLAKDKVGQTWFQIFATDKDRWDNAYCYGFIRLSLIGTYNLNDLHDCSKALPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTCGCTTACGTCTTCGCCGCTCTTGCGGTGCCCATCTACGCCCATCCCAGCATGACCAATCTGGTGAACGAACTCATGAGCCGCCAAGCTGATGACAGCACTCTTGAAAACGAT
GACATTGCCGCGGACCTTCATAAGGTTTCCGACTCTTCTCTTACATCTGTCGGCCAAGAGATCAGGGATCTGCTGGCTCGCAAAGGCAACCCGCAGACCACAGAACATTACGGTTCGGTT
CCCGACCTGGGTTCAGACAAATGCCAAAAGGACACCTGCTGTGTATGGAGCTACATCGGCAAGGAAATGAGGGACACCTTTCTCAATCCTGACGATTCTTGCAACCGCTTCGCCCGTCAG
ATGGTCCGTTTGGGCTTCCATGATTGCATCACTCATGCGGGCCGTGGTAAGGGCGGTTGCGACGGCTCTATCGTCAACTCGAATGACGAGAATGCACGCGTGGAGAACAAGGGCATGCAA
GAGATCACGAGCAAGTTGAAGCAATGGTTCAACAAGTACGAAAAGTACGGCATCACCATGGCCGACTTGATCCAGTTTGGTGCTTCCGTCGCCGTTCACACATGCCCCGGCGGCCCGAGC
TGCAAGGTCTTCATGGGACGTCAGGATACGAACGACGCGAACCCGTCCGGCCTGGTTCCCACGCCCTTCGACACGGCGGAGCAGCTCATCCAGAAGTTCAAGGCCAAGTCCCTCGACGAA
CAGAGCCTCGCCTCGCTGCTCGGCTCCCACACGATCAGCCAACAGTTTGTCGTTGATCCCAAGCGCGCCGGTGATCCCCAGGACAGCACGCCTACCAAATGGGACCAGAAGTACTACGTG
CAGACCCTGGACCAGAGCAAGGCACCGAGCAACGTCTTCTCGTTCGCCAGCGACATCAACCTGGCCAAGGACAAGGTCGGCCAGACCTGGTTCCAGATCTTCGCTACTGACAAGGACCGC
TGGGACAAC
GTGAGTCTTATACCCTTGATCATTTCATTAGGGTGCCGCCGGGACAAACGAATATTGACACCCTGTGATAGGCATACTGTTACGGATTTATCCGCCTCAGCCTTATCGGCA
CCTACAATCTCAACGATTTGCATGACTGCAGCAAGGCGTTGCCTGTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTCGCTTACGTCTTCGCCGCTCTTGCGGTGCCCATCTACGCCCATCCCAGCATGACCAATCTGGTGAACGAACTCATGAGCCGCCAAGCTGATGACAGCACTCTTGAAAACGAT
GACATTGCCGCGGACCTTCATAAGGTTTCCGACTCTTCTCTTACATCTGTCGGCCAAGAGATCAGGGATCTGCTGGCTCGCAAAGGCAACCCGCAGACCACAGAACATTACGGTTCGGTT
CCCGACCTGGGTTCAGACAAATGCCAAAAGGACACCTGCTGTGTATGGAGCTACATCGGCAAGGAAATGAGGGACACCTTTCTCAATCCTGACGATTCTTGCAACCGCTTCGCCCGTCAG
ATGGTCCGTTTGGGCTTCCATGATTGCATCACTCATGCGGGCCGTGGTAAGGGCGGTTGCGACGGCTCTATCGTCAACTCGAATGACGAGAATGCACGCGTGGAGAACAAGGGCATGCAA
GAGATCACGAGCAAGTTGAAGCAATGGTTCAACAAGTACGAAAAGTACGGCATCACCATGGCCGACTTGATCCAGTTTGGTGCTTCCGTCGCCGTTCACACATGCCCCGGCGGCCCGAGC
TGCAAGGTCTTCATGGGACGTCAGGATACGAACGACGCGAACCCGTCCGGCCTGGTTCCCACGCCCTTCGACACGGCGGAGCAGCTCATCCAGAAGTTCAAGGCCAAGTCCCTCGACGAA
CAGAGCCTCGCCTCGCTGCTCGGCTCCCACACGATCAGCCAACAGTTTGTCGTTGATCCCAAGCGCGCCGGTGATCCCCAGGACAGCACGCCTACCAAATGGGACCAGAAGTACTACGTG
CAGACCCTGGACCAGAGCAAGGCACCGAGCAACGTCTTCTCGTTCGCCAGCGACATCAACCTGGCCAAGGACAAGGTCGGCCAGACCTGGTTCCAGATCTTCGCTACTGACAAGGACCGC
TGGGACAAC
GCATACTGTTACGGATTTATCCGCCTCAGCCTTATCGGCACCTACAATCTCAACGATTTGCATGACTGCAGCAAGGCGTTGCCTGTTTAA

Retrieve as FASTA