Entry information : VaaCIIAA03
Entry ID 6831
Creation 2009-05-22 (Christophe Dunand)
Last sequence changes 2017-05-22 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-05-22 (Catherine Mathe)
Peroxidase information: VaaCIIAA03
Name VaaCIIAA03
Class Asco Class II type A    [Orthogroup: CIIAA003]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Verticillium
Organism Verticillium albo-atrum    [TaxId: 27335 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value VaaCIIAA03
start..stop
S start..stop
VdaCIIAA03 494 2e-177 1..358 1..351
CfioCIIAA01_PJ7 292 8e-97 3..358 7..360
CfioCIIAA01_MH18 291 2e-96 3..358 7..360
CgloCIIAA03_ST23 287 1e-94 3..358 4..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6411..7400 990 N° 2 6266..6352 87  
complement(join(6266..6352,6411..7400))


exon

Literature and cross-references VaaCIIAA03
DNA ref. GenBank:   ABPE01004044.1 (7400..6266) [Incorrect prediction]
Protein sequence: VaaCIIAA03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (342)
PWM (Da):   %s   39596.85 (37779.8)  
PI (pH):   %s   6.26 (5.98) Peptide Signal:   %s   cut: 17 range:17-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVAFVLAAFAVPIYAHPSMSNLLNELMARDVDDSPLDNDDVLSSLNGASDSSLTPVGRDLKKILVGKGIAQDPHSSGLTTEKYTSVPKLDSDKCNKDTCCVWSYIGQDLKELFTNPDNSCNRFARQIIRLAFHDCIPHAGRNKGGCDASIVNSKEENGRLENQGIQEITSKLKEVYAKYDDKGISMADLIQFGASVAVHTCPGGPRYRVFMGRKDTTDANPAGLVPSPTDTADVILRKFREKSFLPRNVIALLGAHTVSQQFFINTGLAGQAQDTTPTKWDQNYFAQTLDSSKAKSPIFTFQSDINLAKDSDSKSWFELFLKDKDRWDNEYAYAVIRLSLLNIYNLNDLTECSKALP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTGTCGCCTTCGTCTTGGCCGCTTTTGCGGTGCCCATCTACGCCCATCCCAGCATGTCCAATTTGCTGAACGAGCTTATGGCCCGCGATGTTGACGATTCACCCCTTGATAACGAC
GATGTCTTGTCGAGCTTGAATGGAGCTTCCGACTCGTCTCTAACACCCGTTGGCAGAGACCTCAAGAAAATTCTGGTCGGCAAAGGCATAGCGCAGGACCCTCACAGTAGCGGACTGACT
ACTGAAAAGTACACCAGCGTTCCCAAACTGGACTCGGACAAGTGCAACAAAGACACCTGCTGCGTCTGGAGCTACATCGGCCAAGATTTGAAGGAGCTCTTTACCAACCCCGACAATTCT
TGCAATCGCTTTGCCCGTCAGATCATTCGTCTGGCCTTCCATGATTGCATTCCCCATGCAGGCCGCAACAAAGGTGGCTGTGATGCCTCTATCGTCAACTCGAAGGAAGAGAATGGACGC
CTCGAGAATCAGGGCATACAGGAGATCACGAGCAAGCTGAAAGAGGTGTACGCCAAGTACGACGACAAAGGTATCAGCATGGCCGATTTGATTCAGTTTGGCGCTTCCGTCGCAGTCCAC
ACGTGCCCCGGCGGCCCACGCTACAGGGTCTTCATGGGACGCAAGGATACGACAGACGCGAACCCGGCAGGCCTCGTGCCCTCGCCCACCGACACCGCAGACGTCATCCTCAGGAAGTTC
CGCGAGAAGTCTTTCCTCCCACGCAATGTCATTGCCCTCCTCGGCGCCCACACCGTCAGTCAGCAGTTTTTTATCAACACCGGGCTTGCCGGCCAGGCACAGGACACCACGCCTACCAAG
TGGGACCAGAACTATTTCGCGCAGACTCTGGACTCGAGCAAGGCGAAGAGCCCCATCTTCACATTCCAAAGCGACATTAACCTAGCCAAGGACAGCGACAGCAAGTCTTGGTTCGAGTTG
TTCCTTAAGGACAAGGATCGCTGGGACAAC
GTGAGTCCTGAGCCTTCTGCTCTTCCAATTTGTACCTAATACTGACATCCCGGGATAGGAATATGCCTACGCCGTTATCCGCCTTAGCCT
GCTTAACATATACAACCTTAACGACCTGACGGAATGCAGCAAGGCGCTGCCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTGTCGCCTTCGTCTTGGCCGCTTTTGCGGTGCCCATCTACGCCCATCCCAGCATGTCCAATTTGCTGAACGAGCTTATGGCCCGCGATGTTGACGATTCACCCCTTGATAACGAC
GATGTCTTGTCGAGCTTGAATGGAGCTTCCGACTCGTCTCTAACACCCGTTGGCAGAGACCTCAAGAAAATTCTGGTCGGCAAAGGCATAGCGCAGGACCCTCACAGTAGCGGACTGACT
ACTGAAAAGTACACCAGCGTTCCCAAACTGGACTCGGACAAGTGCAACAAAGACACCTGCTGCGTCTGGAGCTACATCGGCCAAGATTTGAAGGAGCTCTTTACCAACCCCGACAATTCT
TGCAATCGCTTTGCCCGTCAGATCATTCGTCTGGCCTTCCATGATTGCATTCCCCATGCAGGCCGCAACAAAGGTGGCTGTGATGCCTCTATCGTCAACTCGAAGGAAGAGAATGGACGC
CTCGAGAATCAGGGCATACAGGAGATCACGAGCAAGCTGAAAGAGGTGTACGCCAAGTACGACGACAAAGGTATCAGCATGGCCGATTTGATTCAGTTTGGCGCTTCCGTCGCAGTCCAC
ACGTGCCCCGGCGGCCCACGCTACAGGGTCTTCATGGGACGCAAGGATACGACAGACGCGAACCCGGCAGGCCTCGTGCCCTCGCCCACCGACACCGCAGACGTCATCCTCAGGAAGTTC
CGCGAGAAGTCTTTCCTCCCACGCAATGTCATTGCCCTCCTCGGCGCCCACACCGTCAGTCAGCAGTTTTTTATCAACACCGGGCTTGCCGGCCAGGCACAGGACACCACGCCTACCAAG
TGGGACCAGAACTATTTCGCGCAGACTCTGGACTCGAGCAAGGCGAAGAGCCCCATCTTCACATTCCAAAGCGACATTAACCTAGCCAAGGACAGCGACAGCAAGTCTTGGTTCGAGTTG
TTCCTTAAGGACAAGGATCGCTGGGACAAC
GAATATGCCTACGCCGTTATCCGCCTTAGCCTGCTTAACATATACAACCTTAACGACCTGACGGAATGCAGCAAGGCGCTGCCTTGA

Retrieve as FASTA