Entry information : ChigCIIAA03
Entry ID 6839
Creation 2009-06-04 (Christophe Dunand)
Last sequence changes 2011-08-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-08-25 (Christophe Dunand)
Peroxidase information: ChigCIIAA03
Name ChigCIIAA03
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Colletotrichum
Organism Colletotrichum higginsianum    [TaxId: 80884 ]
Cellular localisation N/D
Tissue type Appressorium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ChigCIIAA03
start..stop
S start..stop
CgraCIIAA03 729 0 1..406 1..406
CfioCIIAA03_MH18 697 0 1..403 1..403
CfioCIIAA03_PJ7 696 0 1..403 1..403
CgloCIIAA01_Naragc5 550 0 1..402 1..401
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..999 999 N° 2 1077..1298 222  
join(1..999,1077..1298)


exon

Literature and cross-references ChigCIIAA03
Literature Kleemann,J., Takahara,H., Stuber,K. and O'Connell,R. Identification of soluble secreted proteins from appressoria of Colletotrichum higginsianum by analysis of expressed sequence tags. Microbiology 154 (Pt 4), 1204-1217 (2008).
DNA ref. Broad_Colleto:   S7000006585848688
EST ref. GenBank:   AM497425.1 [5' end]   AM497429.1 [Fragment]
Protein sequence: ChigCIIAA03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   407 (389)
PWM (Da):   %s   43619.96 (41900.0)  
PI (pH):   %s   4.78 (4.71) Peptide Signal:   %s   cut: 18 range:18-406
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTASLIAALVAGIALARPGMDIKKLIADAQLQIRQIGGGGPSTELIGDLVELRERELTATGAAIRDILITEASGQDVDTFYDESELAPKGSEECDSDDCCIWKYIADDLAKQMVGTAGRCNSVARGAIRLGFHDAAAWSKSTGGTGADGSIILANECKTRSDNKGLEEICDMTATWFAKYKKFGISMADLIQLSANVATVSCPLGPRVRTFVGRKDSSTPATKNLLPDPSDSSAKLFKLFGEKSFTPAGLVALLGAHSTSQQRFVDPSRADSPQDSTPGTWDIAFYQQTLNPNAPPAVFKFQSDIHVSLDPETNEVWRMFAAGPRGQAVWNQAYASEYVRMSLLGVNNINDLTECTKVLPPFRPAFEQPDQDLLDKVMGSVLNSDLVKQALEKGDKIPPAALSNP*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACCGCGTCTCTCATTGCCGCCCTTGTGGCGGGCATTGCTCTCGCTCGTCCTGGCATGGACATCAAGAAGCTGATAGCCGACGCCCAGCTGCAGATCCGTCAGATTGGTGGCGGT
GGCCCTTCGACAGAGCTGATCGGCGACCTCGTCGAACTCCGCGAGCGCGAACTGACAGCGACCGGGGCCGCCATCAGGGATATCTTGATCACCGAGGCCTCGGGCCAGGACGTGGATACC
TTTTACGACGAGTCTGAATTAGCACCGAAGGGTTCCGAGGAGTGCGACAGTGACGATTGTTGCATTTGGAAGTACATCGCCGACGACTTGGCCAAGCAGATGGTGGGCACTGCCGGCCGG
TGCAACAGCGTCGCCCGCGGCGCTATCCGTCTTGGTTTCCACGACGCCGCCGCCTGGTCCAAGTCGACGGGCGGCACAGGTGCCGACGGCTCCATCATCCTCGCCAACGAGTGCAAGACG
CGCTCCGATAACAAAGGCCTCGAGGAGATCTGCGACATGACGGCGACCTGGTTTGCCAAGTACAAGAAGTTCGGCATCAGCATGGCAGACCTGATCCAGTTGTCCGCCAACGTCGCCACG
GTCTCATGTCCTCTCGGCCCTCGCGTCCGCACTTTTGTCGGCCGCAAGGACTCATCCACCCCCGCCACCAAGAACCTCCTCCCCGATCCCTCGGACAGCTCCGCCAAGCTGTTCAAGCTG
TTTGGGGAGAAGTCCTTCACGCCCGCCGGTCTTGTGGCCCTCCTGGGTGCCCACAGCACCAGCCAGCAACGCTTTGTCGACCCTTCGCGTGCCGACTCGCCCCAGGATAGCACGCCAGGC
ACGTGGGACATTGCCTTCTATCAGCAGACGCTCAACCCCAACGCGCCGCCCGCCGTCTTCAAATTCCAAAGCGACATCCACGTGTCCCTGGACCCCGAGACCAACGAGGTCTGGAGAATG
TTTGCAGCGGGGCCGCGCGGTCAAGCCGTGTGGAACCAG
GTATGGAAAAAGATTTCCCGTCACACCTTCGTCCCATCTGATATAACCTTGTTTCCGACCTAACACCTAAAATTCAGGCCT
ATGCGTCCGAGTATGTTCGCATGTCTCTCCTCGGCGTCAACAACATCAACGACCTGACGGAGTGCACAAAGGTCTTGCCGCCTTTCCGCCCTGCCTTTGAGCAGCCTGACCAAGACCTCC
TCGACAAGGTCATGGGCTCCGTCCTTAACTCGGACCTCGTCAAGCAGGCGTTGGAGAAGGGCGACAAGATTCCTCCCGCCGCATTGTCGAACCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACCGCGTCTCTCATTGCCGCCCTTGTGGCGGGCATTGCTCTCGCTCGTCCTGGCATGGACATCAAGAAGCTGATAGCCGACGCCCAGCTGCAGATCCGTCAGATTGGTGGCGGT
GGCCCTTCGACAGAGCTGATCGGCGACCTCGTCGAACTCCGCGAGCGCGAACTGACAGCGACCGGGGCCGCCATCAGGGATATCTTGATCACCGAGGCCTCGGGCCAGGACGTGGATACC
TTTTACGACGAGTCTGAATTAGCACCGAAGGGTTCCGAGGAGTGCGACAGTGACGATTGTTGCATTTGGAAGTACATCGCCGACGACTTGGCCAAGCAGATGGTGGGCACTGCCGGCCGG
TGCAACAGCGTCGCCCGCGGCGCTATCCGTCTTGGTTTCCACGACGCCGCCGCCTGGTCCAAGTCGACGGGCGGCACAGGTGCCGACGGCTCCATCATCCTCGCCAACGAGTGCAAGACG
CGCTCCGATAACAAAGGCCTCGAGGAGATCTGCGACATGACGGCGACCTGGTTTGCCAAGTACAAGAAGTTCGGCATCAGCATGGCAGACCTGATCCAGTTGTCCGCCAACGTCGCCACG
GTCTCATGTCCTCTCGGCCCTCGCGTCCGCACTTTTGTCGGCCGCAAGGACTCATCCACCCCCGCCACCAAGAACCTCCTCCCCGATCCCTCGGACAGCTCCGCCAAGCTGTTCAAGCTG
TTTGGGGAGAAGTCCTTCACGCCCGCCGGTCTTGTGGCCCTCCTGGGTGCCCACAGCACCAGCCAGCAACGCTTTGTCGACCCTTCGCGTGCCGACTCGCCCCAGGATAGCACGCCAGGC
ACGTGGGACATTGCCTTCTATCAGCAGACGCTCAACCCCAACGCGCCGCCCGCCGTCTTCAAATTCCAAAGCGACATCCACGTGTCCCTGGACCCCGAGACCAACGAGGTCTGGAGAATG
TTTGCAGCGGGGCCGCGCGGTCAAGCCGTGTGGAACCAG
GCCTATGCGTCCGAGTATGTTCGCATGTCTCTCCTCGGCGTCAACAACATCAACGACCTGACGGAGTGCACAAAGGTCTTG
CCGCCTTTCCGCCCTGCCTTTGAGCAGCCTGACCAAGACCTCCTCGACAAGGTCATGGGCTCCGTCCTTAACTCGGACCTCGTCAAGCAGGCGTTGGAGAAGGGCGACAAGATTCCTCCC
GCCGCATTGTCGAACCCGTGA

Retrieve as FASTA