Entry information : BdiPrx79 (Bradi2g37050)
Entry ID 6840
Creation 2009-06-16 (Christophe Dunand)
Last sequence changes 2009-06-16 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: BdiPrx79 (Bradi2g37050)
Name (synonym) BdiPrx79 (Bradi2g37050)
Class Class III peroxidase    [Orthogroup: Prx224]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx79
start..stop
S start..stop
BdiPrx80 496 7e-178 38..351 57..372
BdiPrx81 409 1e-143 2..351 1..341
TaPrx99-1B 371 7e-129 38..351 31..335
TaPrx99-1A 362 4e-125 38..351 31..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37454599..37454814 216 N° 2 37452814..37453653 840  
complement(join(37452814..37453653,37454599..37454814))


exon

Literature and cross-references BdiPrx79 (Bradi2g37050)
DNA ref. Phytozome 12:   Bd2 (37454814..37452814)
Protein sequence: BdiPrx79 (Bradi2g37050)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (322)
PWM (Da):   %s   37316.99 (34348.5) Transmb domain:   %s   i5-27o
PI (pH):   %s   6.89 (6.93) Peptide Signal:   %s   cut: 30 range:30-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKFSAGCVALSLCCCLWLAFLAGLPAEAARGGKKETVEETVKRVVGTAMEGSGRRLGAALVRLLFHDCWVQGCDASVLLDTVPAGSGTGEKDAKNNNGLDGFNLIDDIKAELVRLGETNVSCADILVLAARDATAILSGGTINYAIKRGRVDGVVSSASDADAILPPSTFKIKQLKDNFALKGFTTRELVALSGAHAVGVAHLQSFADRLNSSTETPIDGAYRNALRNHTEAQKTAQGTNDPIELNNIRDMDGKFQTDAGYDATGVNTAVVGVLDNSYYKANLQNRVLFRSDWELRNDTDTAANAGIALAEFGSSASKWFVAFSNAMAKLSDLRAEGPRFEIRKNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 1 intron). No EST. Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGTTCAGTGCTGGCTGTGTCGCGTTGTCTCTGTGCTGCTGCCTTTGGCTTGCATTCTTGGCCGGGCTGCCGGCAGAAGCAGCCCGCGGCGGCAAGAAGGAGACCGTGGAGGAG
ACGGTTAAGAGGGTAGTGGGCACGGCCATGGAGGGCAGCGGTCGCCGCCTCGGCGCCGCCCTCGTCCGGTTGCTCTTCCACGATTGCTGGGTCCAG
GTACGTGCTATATATATACTTCAA
GCCCTCGATAATAAATCTAGTTTATCTTTTCTGCGAACAGGTTAATTAATTATGTGATCCATGTGACCATGCGTTCTGCATGCTGTGTACACGTACGATAGGAGTAATTAATAGGGAGTG
TTTCTAAGTTGACTTGGAAATTCATATTGAGCATTCATTCGAAAATTAAAGTTGACTACTCTGGTTCGATACACACACCCCCTCCTCTAAAGAAAAACACAAAGACGGTCCATATTAATC
CGTACCTCTTCATAAAAAAGGGCACACGACATTAAACAATATTTTCTTTTATCATTTTTCGTATGTCTTCGAACAACACTCGGTGTTTTTAATTTTTCCGGAGATTGCACCATTGGATCG
TCATCAAATTTCACGCTATAGTAGTGGACACAATTCCAAACAATCTCACCGAAGGGATCGACAAAATATTTTTCTTGAGCCAGCGGGAAACAGACGAACAAGTCGGATGTTCATGCTGTC
CCGCACAGCCGCGAGAATTCAAAACAGCACTCAGTGTTTCGAAGCTTTCCGGAGATTCCACCATTGGATCGCGATGAAATTTCACATTGTAGTAGTAGACAAAATTCCGCACAATCTCAC
TGAAGGGATCGGCAAAACACTTCTCGAGGAATCGGGAAACATGCAAACAAGTTGGATGTTCGTGCTGTCCCGCACGGTCGCGAGAAATACAAACAACACTAGGTATTTTGATTTTTTCCG
GAGATTCCACCGTTGGATTGCAATGAAATTTCACACTGGTAGTACACAAAATTCCGCACAATCTCACCAAAAGGATCGTTGAAACATTGTTTGAATCAGCGGGAAATCTGTGAACATCGT
GCTATCCCGTGGGGCCGCAAGAAATCCTACCCTTTTCCGTTTGGAAATATATAGTTTTCCTAATTGCCGTGAGGATGACAGGGTTGCGACGCTTCCGTGCTCTTGGATACGGTGCCGGCC
GGCAGCGGCACCGGCGAGAAGGACGCCAAGAACAACAACGGCCTGGACGGCTTCAACCTGATCGACGACATCAAGGCCGAGCTCGTCCGCCTCGGCGAGACCAACGTCTCCTGCGCCGAC
ATCCTCGTGCTCGCCGCCCGCGACGCGACGGCCATCCTCAGCGGGGGCACAATCAACTACGCCATCAAGCGAGGCCGCGTGGATGGCGTGGTCTCCTCGGCGTCCGACGCCGACGCCATA
CTCCCTCCCTCCACCTTCAAAATAAAGCAACTCAAGGACAACTTCGCCCTCAAGGGCTTCACCACGCGGGAGCTCGTGGCCCTCTCCGGCGCGCACGCCGTCGGCGTCGCCCACCTGCAA
TCCTTCGCCGACCGCCTCAACTCCTCCACGGAGACGCCGATCGACGGAGCCTACCGGAACGCGCTCCGGAACCACACCGAGGCCCAGAAGACGGCGCAAGGAACAAACGACCCGATCGAG
TTGAACAACATCCGTGACATGGACGGGAAGTTCCAGACAGACGCCGGATACGACGCCACGGGGGTGAACACGGCGGTGGTGGGCGTCCTGGACAACAGCTACTACAAGGCCAACCTCCAG
AATAGGGTGCTCTTCAGGTCCGACTGGGAGCTCCGCAACGACACTGACACCGCCGCCAATGCTGGAATTGCTCTGGCAGAGTTCGGCAGCAGCGCCAGCAAGTGGTTCGTCGCCTTCAGC
AATGCCATGGCCAAGCTTAGTGATCTCCGTGCCGAGGGCCCACGCTTCGAGATCAGAAAGAACTGCAGAAAGATTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGTTCAGTGCTGGCTGTGTCGCGTTGTCTCTGTGCTGCTGCCTTTGGCTTGCATTCTTGGCCGGGCTGCCGGCAGAAGCAGCCCGCGGCGGCAAGAAGGAGACCGTGGAGGAG
ACGGTTAAGAGGGTAGTGGGCACGGCCATGGAGGGCAGCGGTCGCCGCCTCGGCGCCGCCCTCGTCCGGTTGCTCTTCCACGATTGCTGGGTCCAG
GGTTGCGACGCTTCCGTGCTCTTG
GATACGGTGCCGGCCGGCAGCGGCACCGGCGAGAAGGACGCCAAGAACAACAACGGCCTGGACGGCTTCAACCTGATCGACGACATCAAGGCCGAGCTCGTCCGCCTCGGCGAGACCAAC
GTCTCCTGCGCCGACATCCTCGTGCTCGCCGCCCGCGACGCGACGGCCATCCTCAGCGGGGGCACAATCAACTACGCCATCAAGCGAGGCCGCGTGGATGGCGTGGTCTCCTCGGCGTCC
GACGCCGACGCCATACTCCCTCCCTCCACCTTCAAAATAAAGCAACTCAAGGACAACTTCGCCCTCAAGGGCTTCACCACGCGGGAGCTCGTGGCCCTCTCCGGCGCGCACGCCGTCGGC
GTCGCCCACCTGCAATCCTTCGCCGACCGCCTCAACTCCTCCACGGAGACGCCGATCGACGGAGCCTACCGGAACGCGCTCCGGAACCACACCGAGGCCCAGAAGACGGCGCAAGGAACA
AACGACCCGATCGAGTTGAACAACATCCGTGACATGGACGGGAAGTTCCAGACAGACGCCGGATACGACGCCACGGGGGTGAACACGGCGGTGGTGGGCGTCCTGGACAACAGCTACTAC
AAGGCCAACCTCCAGAATAGGGTGCTCTTCAGGTCCGACTGGGAGCTCCGCAACGACACTGACACCGCCGCCAATGCTGGAATTGCTCTGGCAGAGTTCGGCAGCAGCGCCAGCAAGTGG
TTCGTCGCCTTCAGCAATGCCATGGCCAAGCTTAGTGATCTCCGTGCCGAGGGCCCACGCTTCGAGATCAGAAAGAACTGCAGAAAGATTAACTAG

Retrieve as FASTA