Entry information : BdiPrx[P]82 (Bradi2g37080)
Entry ID 6842
Creation 2009-06-16 (Christophe Dunand)
Last sequence changes 2011-01-19 (Toky Ramarohetra)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx[P]82 (Bradi2g37080)
Name (synonym) BdiPrx[P]82 (Bradi2g37080)
Class Class III peroxidase     [Orthogroup: Prx044]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx[P]82
start..stop
S start..stop
BdiPrx83 295 2e-98 1..345 1..374
BdiPrx81 292 7e-98 32..341 27..341
TaPrx99-1A 286 2e-95 40..346 31..340
TaPrx99-1D 283 2e-94 40..346 31..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37464837..37465055 219 N° 2 37463630..37464448 819  
complement(join(37463630..37464448,37464837..37465055))


exon

Literature and cross-references BdiPrx[P]82 (Bradi2g37080)
DNA ref. Phytozome 12:   Bd2 (37465055..37463630)
Protein sequence: BdiPrx[P]82 (Bradi2g37080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (313)
PWM (Da):   %s   37396.15 (34300.4) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.1 (6.52) Peptide Signal:   %s   cut: 33 range:33-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKRGGGLSFCELVALAAAAVLLAAQAKLAVAGGYYNPAIEDVVREEVQKGIKTYPGVGPGLIRLLFHDCWVKGCDGSVLLERAD*KAEKYAAASIGLRGFEVIDAIKAKLTAHGVTCTDAIIYAAREATIHLSRGKIKYYVAGPGRKDGLVSSAEHANEFLPLPTASFPDLVEIFKTKGFDATELVVLSGAHAVGVANYTSFKHRLRLPAVGKINTLYQLQLGVQTAKDGVTTPNPNESNNVRDMDNVRKLSFYDDQGVNVADKGVLDNSYYTANLQNMVLFNSDWVLTQDKAARDAMELYKKDADTWYDLFGKAMGKLSELPMDEGAGWEIRKNCRTTNDASWY

Retrieve as FASTA  
Remarks Pseudogene from genomic (chromo 2, 1 intron). Sequence contains a stop codon in frame. Incorrect prediction from Phytozome (DAS is spliced to removed the stop)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGCGTGGCGGGGGGTTGTCCTTTTGCGAGCTCGTGGCCTTGGCCGCCGCCGCCGTTCTACTCGCGGCGCAGGCGAAGCTGGCGGTGGCCGGCGGCTACTACAACCCTGCAATT
GAGGACGTTGTGAGGGAAGAAGTGCAGAAGGGCATAAAGACCTATCCCGGCGTCGGCCCTGGTCTCATCCGGCTCCTGTTCCACGACTGCTGGGTCAAG
GTAACATATAGGCTGCCTTTT
GGCTTTACAATTGCGGTGCAGGTCTTGTAAAAACATTTTTTTTAATCTTTCTGTTAGCATATTGTAGATAGCTGCAAAACTTTTACGTTTAGAAACATCAACAGCAAATCATCTGCTGAA
ATTGGTAACACGTCTCATTATTTCGGGCACTTCAATGCATTGTGGTTCAGCAATGAGAATGGAATTTTACCTTTTTGTTCAAACAATCTCATGACGGGTTTTCTCTATCAGGAGATAACG
GAAAGACAAAGGTTCTAAAACAATGAAAAACTTTACCGATTTAGATGGCTGTTTGATGTAGAGGACGGGGGTATTCGCTCCTTTTCGAGAAAAATAAAGCTGACCTTAAAATATTTAATG
TCCTTAGGGTTGCGATGGATCCGTGTTGCTGGAGAGAGCTGACTGAAAGGCCGAGAAGTACGCGGCAGCCAGCATCGGTCTCCGCGGCTTCGAGGTGATTGACGCCATCAAGGCCAAGCT
CACCGCCCACGGCGTCACCTGCACGGACGCCATCATCTACGCGGCGCGCGAAGCAACCATCCACCTCAGCCGTGGCAAAATCAAGTACTACGTCGCCGGGCCAGGCCGTAAGGACGGCCT
CGTCTCATCCGCAGAGCACGCCAACGAGTTCCTCCCGCTCCCCACCGCCAGCTTCCCGGACCTCGTAGAGATATTCAAAACCAAGGGCTTCGACGCCACGGAGCTCGTCGTCCTCTCCGG
CGCACACGCCGTGGGCGTCGCAAACTACACCTCCTTCAAGCACCGCCTGCGACTGCCCGCCGTCGGCAAGATCAACACCTTGTACCAACTCCAGCTCGGCGTGCAGACAGCGAAAGACGG
TGTAACGACGCCGAACCCGAACGAGAGCAACAACGTCCGCGACATGGACAATGTCCGGAAACTGTCCTTCTATGACGACCAAGGGGTTAACGTGGCGGACAAGGGTGTCCTGGACAACAG
CTACTACACGGCCAACCTCCAGAACATGGTGCTCTTCAACTCCGATTGGGTGCTGACGCAGGACAAGGCTGCCAGGGACGCGATGGAACTGTACAAGAAGGACGCCGACACGTGGTACGA
CCTCTTTGGCAAGGCCATGGGTAAGCTCAGCGAGCTTCCCATGGACGAGGGCGCCGGTTGGGAGATCAGGAAGAACTGCAGAACCACTAACGATGCCAGCTGGTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGCGTGGCGGGGGGTTGTCCTTTTGCGAGCTCGTGGCCTTGGCCGCCGCCGCCGTTCTACTCGCGGCGCAGGCGAAGCTGGCGGTGGCCGGCGGCTACTACAACCCTGCAATT
GAGGACGTTGTGAGGGAAGAAGTGCAGAAGGGCATAAAGACCTATCCCGGCGTCGGCCCTGGTCTCATCCGGCTCCTGTTCCACGACTGCTGGGTCAAG
GGTTGCGATGGATCCGTGTTG
CTGGAGAGAGCTGACTGAAAGGCCGAGAAGTACGCGGCAGCCAGCATCGGTCTCCGCGGCTTCGAGGTGATTGACGCCATCAAGGCCAAGCTCACCGCCCACGGCGTCACCTGCACGGAC
GCCATCATCTACGCGGCGCGCGAAGCAACCATCCACCTCAGCCGTGGCAAAATCAAGTACTACGTCGCCGGGCCAGGCCGTAAGGACGGCCTCGTCTCATCCGCAGAGCACGCCAACGAG
TTCCTCCCGCTCCCCACCGCCAGCTTCCCGGACCTCGTAGAGATATTCAAAACCAAGGGCTTCGACGCCACGGAGCTCGTCGTCCTCTCCGGCGCACACGCCGTGGGCGTCGCAAACTAC
ACCTCCTTCAAGCACCGCCTGCGACTGCCCGCCGTCGGCAAGATCAACACCTTGTACCAACTCCAGCTCGGCGTGCAGACAGCGAAAGACGGTGTAACGACGCCGAACCCGAACGAGAGC
AACAACGTCCGCGACATGGACAATGTCCGGAAACTGTCCTTCTATGACGACCAAGGGGTTAACGTGGCGGACAAGGGTGTCCTGGACAACAGCTACTACACGGCCAACCTCCAGAACATG
GTGCTCTTCAACTCCGATTGGGTGCTGACGCAGGACAAGGCTGCCAGGGACGCGATGGAACTGTACAAGAAGGACGCCGACACGTGGTACGACCTCTTTGGCAAGGCCATGGGTAAGCTC
AGCGAGCTTCCCATGGACGAGGGCGCCGGTTGGGAGATCAGGAAGAACTGCAGAACCACTAACGATGCCAGCTGGTAC

Retrieve as FASTA