Entry information : BdiPrx83 (Bradi2g37090)
Entry ID 6843
Creation 2009-06-17 (Christophe Dunand)
Last sequence changes 2009-06-17 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: BdiPrx83 (Bradi2g37090)
Name (synonym) BdiPrx83 (Bradi2g37090)
Class Class III peroxidase    [Orthogroup: Prx100]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx83
start..stop
S start..stop
BdiPrx90 301 7e-101 16..351 7..329
BdiPrx88 296 8e-99 11..361 5..338
BdiPrx87 283 4e-94 1..373 1..327
BdiPrx89 279 1e-92 1..370 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37467519..37467722 204 N° 2 37466449..37467369 921  
complement(join(37466449..37467369,37467519..37467722))


exon

Literature and cross-references BdiPrx83 (Bradi2g37090)
DNA ref. Phytozome 12:   Bd2 (37467722..37466449)
Protein sequence: BdiPrx83 (Bradi2g37090)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374 (350)
PWM (Da):   %s   40227.39 (37755.9) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.65 (7.06) Peptide Signal:   %s   cut: 33 range:25-374
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKRNEKGPLSVLLALAIAVVLLAAQVKPAVGGGYTDPMQAEVRKIVGGRLYDAPGLIRLLFHDCWVQGCDGSVLLTETPYKSKDGKTEQDGPANIGLRGLDMIQAIKDKLYAHDNAVTCADAVVYAAREATYLLSNKQIIYDVAGPGSHRDGLVSSADKTNVLPGPTSGYDDLVKNFHDNGGLDHEDLVALSGAHGVGKAHLSTFADRFGPAADDEINHAYRDALKKRIPKEASDDALALHNLGLLSFNPAAKNDAAGKLKSNPTVENNVRDMDDVRSESGYDATGVSLAPKGALDNSYYTANLQNMVLFKSDWALTTNHTAKAKMVDYKKDAKAWYARFGKAMEKLSKLKDNNARYENEPRTNCSATNKKSY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1). No EST. Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGCGCAACGAGAAGGGTCCTCTTTCAGTTCTCCTGGCTTTGGCCATCGCTGTGGTCCTCCTCGCCGCGCAGGTGAAGCCGGCGGTGGGTGGCGGCTACACCGATCCTATGCAG
GCTGAGGTGAGGAAGATAGTGGGGGGCAGACTCTACGACGCCCCTGGCCTCATCCGTCTCCTCTTCCACGACTGCTGGGTCCAG
GTAACTAAACCTGATTTTGACACACATTGCCGAAGT
GATTATTTACAAAAGATGTTTTTTTTTCTATTTCACTACCTGGATATTGTAGATTTATTGCAATCTAGTTATAGACTTATAGCGCGTTGATGCGATAATATGTTACATATTAGGGTTGCG
ATGGATCCGTGCTGCTAACTGAGACACCGTACAAGAGCAAAGACGGGAAGACGGAGCAGGACGGGCCGGCGAACATCGGCCTCCGGGGCTTGGACATGATCCAAGCGATCAAGGACAAGC
TCTACGCCCACGACAATGCCGTGACCTGCGCCGACGCGGTCGTCTACGCTGCACGTGAGGCCACATACCTCCTCAGCAACAAGCAGATCATCTACGACGTCGCCGGGCCGGGCTCCCACA
GGGACGGCCTCGTCTCCTCCGCGGACAAAACCAACGTCCTCCCAGGGCCGACCTCCGGCTACGACGACCTCGTGAAGAACTTCCATGACAATGGCGGCCTCGACCACGAAGACCTCGTGG
CCCTCTCCGGCGCGCACGGCGTCGGCAAAGCCCACCTCTCGACCTTCGCCGACCGCTTCGGCCCGGCCGCCGACGATGAGATCAACCACGCCTACAGAGATGCCCTCAAGAAGCGCATCC
CCAAGGAAGCGTCAGATGATGCATTGGCTTTGCACAACTTGGGCTTGTTGTCCTTCAACCCGGCGGCAAAGAACGACGCCGCCGGCAAGCTCAAGTCCAACCCGACGGTGGAGAACAATG
TCCGTGACATGGACGATGTCCGGAGCGAGTCCGGCTACGACGCCACCGGGGTGAGCCTGGCGCCCAAGGGTGCCCTGGACAACAGCTACTACACCGCCAACCTCCAGAACATGGTGCTCT
TCAAGTCCGACTGGGCGCTCACCACCAACCACACCGCCAAGGCCAAGATGGTGGACTACAAGAAGGACGCCAAGGCGTGGTACGCCCGCTTCGGCAAGGCCATGGAAAAGCTCAGCAAGC
TTAAGGACAATAACGCCCGTTACGAGAATGAGCCTCGGACCAACTGCAGTGCCACCAACAAGAAGAGCTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGCGCAACGAGAAGGGTCCTCTTTCAGTTCTCCTGGCTTTGGCCATCGCTGTGGTCCTCCTCGCCGCGCAGGTGAAGCCGGCGGTGGGTGGCGGCTACACCGATCCTATGCAG
GCTGAGGTGAGGAAGATAGTGGGGGGCAGACTCTACGACGCCCCTGGCCTCATCCGTCTCCTCTTCCACGACTGCTGGGTCCAG
GGTTGCGATGGATCCGTGCTGCTAACTGAGACACCG
TACAAGAGCAAAGACGGGAAGACGGAGCAGGACGGGCCGGCGAACATCGGCCTCCGGGGCTTGGACATGATCCAAGCGATCAAGGACAAGCTCTACGCCCACGACAATGCCGTGACCTGC
GCCGACGCGGTCGTCTACGCTGCACGTGAGGCCACATACCTCCTCAGCAACAAGCAGATCATCTACGACGTCGCCGGGCCGGGCTCCCACAGGGACGGCCTCGTCTCCTCCGCGGACAAA
ACCAACGTCCTCCCAGGGCCGACCTCCGGCTACGACGACCTCGTGAAGAACTTCCATGACAATGGCGGCCTCGACCACGAAGACCTCGTGGCCCTCTCCGGCGCGCACGGCGTCGGCAAA
GCCCACCTCTCGACCTTCGCCGACCGCTTCGGCCCGGCCGCCGACGATGAGATCAACCACGCCTACAGAGATGCCCTCAAGAAGCGCATCCCCAAGGAAGCGTCAGATGATGCATTGGCT
TTGCACAACTTGGGCTTGTTGTCCTTCAACCCGGCGGCAAAGAACGACGCCGCCGGCAAGCTCAAGTCCAACCCGACGGTGGAGAACAATGTCCGTGACATGGACGATGTCCGGAGCGAG
TCCGGCTACGACGCCACCGGGGTGAGCCTGGCGCCCAAGGGTGCCCTGGACAACAGCTACTACACCGCCAACCTCCAGAACATGGTGCTCTTCAAGTCCGACTGGGCGCTCACCACCAAC
CACACCGCCAAGGCCAAGATGGTGGACTACAAGAAGGACGCCAAGGCGTGGTACGCCCGCTTCGGCAAGGCCATGGAAAAGCTCAGCAAGCTTAAGGACAATAACGCCCGTTACGAGAAT
GAGCCTCGGACCAACTGCAGTGCCACCAACAAGAAGAGCTACTAA

Retrieve as FASTA