Entry information : MlpDyPrx01
Entry ID 6850
Creation 2009-06-22 (Christophe Dunand)
Last sequence changes 2009-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: MlpDyPrx01
Name MlpDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Melampsoraceae Melampsora
Organism Melampsora laricis-populina    [TaxId: 203908 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MlpDyPrx01
start..stop
S start..stop
MlpDyPrx02 726 0 1..495 1..497
CqueDyPrx01 712 0 1..495 1..491
PgrDyPrx01 601 0 1..494 1..502
PgrDyPrx08 596 0 1..494 1..502
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 937361..937404 44 N° 2 936696..937287 592 N° 3 936344..936629 286 N° 4 936125..936239 115
N° 5 935960..936048 89 N° 6 935763..935875 113 N° 7 935518..935640 123 N° 8 935358..935425 68
N° 9 935228..935285 58  
complement(join(935228..935285,935358..935425,935518..935640,935763..935875,9359 60..936048,936125..936239,936344..936629,936696..937287,937361..937404))


exon

Literature and cross-references MlpDyPrx01
DNA ref. JGI genome:   scaffold_18 (937404..935228)
mRNA ref. JGI transcript:   43449
Protein sequence: MlpDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   495
PWM (Da):   %s   54149.96  
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSQTVFQSTPSSNSIVDANNVQGDVVIGLIKRVECFLFLTLKDDNESRLAFRRTLKDKLLPLITTTQQVLETQRKIDESKRQTKPGQPKKILPITQFNIAFSASGLKKLGVGDTEIPSDNAAFIATQKSDAVTNLGDPVDSKGQKLLTWSPDFLQHSIDAVILITAPDQESLCRKIDEIKTIVKDSISRQFSRTGNVRPGSEAGHEHFGFDGISTPKIKGFNSTQADEQAGVVNPSVILVGHPDETNPSTTSPAWMKDGSFLAIRELQQLVPEFQKFCDETAKKNPIPGVTGEFIGARVVGRWKSGAPLTLAPIEDNSKLIGAQNFDYADELEQQRCPYAAHVRKTNPRKGFAGFEPETAVLPHLMVRNGIPGPELTKEEIEEKQTKHNRGLLFVSYQSKIENGFQFVQSWSNNVDFPIKNPAKVTPGFDLLIGQSGNGGPRTAQNITSNGMAGETDPNNVITAPTEFIKTLGGEYFFSPSIEAIRTKLGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCTCAAACCGTATTCCAATCTACTCCAAGCTCTAACAGGTCTGCACCTTTCGCTACCAATCTCTTTCAATTTGATTGCTAATATGACATCTTCACCCTGATATATCCTCAGCAT
CGTCGATGCCAATAACGTGCAGGGCGACGTTGTCATTGGACTCATCAAGCGTGTCGAATGTTTTTTGTTTTTGACACTGAAGGATGACAATGAGTCTCGACTAGCCTTCCGTCGAACATT
GAAAGACAAGCTTCTGCCTCTGATCACCACCACTCAACAAGTCCTCGAAACTCAACGGAAGATAGATGAGAGCAAACGTCAAACCAAGCCCGGCCAGCCTAAGAAGATCTTACCGATCAC
TCAGTTCAATATTGCCTTCAGTGCATCTGGATTAAAGAAATTAGGAGTCGGTGATACTGAGATCCCCAGTGACAATGCTGCTTTCATTGCCACTCAAAAGTCTGATGCAGTGACGAATCT
CGGCGACCCTGTTGATTCAAAGGGTCAAAAGCTCTTGACCTGGTCCCCTGATTTTCTTCAACACTCTATAGACGCTGTGATCTTGATTACTGCTCCGGACCAGGAGTCATTATGTCGTAA
GATCGACGAAATCAAGACCATCGTTAAAGATTCTATATCTCGTCAATTTTCACGCACTGGAAATGTCCGACCTGGTTCTGAAGCTGGGCATGAGCATTTTGGCTTTCTG
GTATGTGTTCA
ACTAGGTTTTACTATCTCCCTCCACTTCGTGTTTCACATCTTGTTTTTTGTTCAGGATGGTATCTCGACTCCGAAAATCAAGGGCTTCAATTCTACCCAAGCGGACGAGCAAGCCGGCGT
TGTAAACCCGAGTGTGATCTTAGTTGGGCACCCGGATGAAACCAACCCATCAACTACATCACCAGCATGGATGAAAGACGGATCCTTCCTTGCTATACGTGAGCTTCAGCAACTCGTCCC
AGAATTTCAAAAGTTCTGTGATGAGACTGCGAAGAAGAACCCGATCCCCGGTGTCACTGGTGAATTCATTGGTGCGAGAGTCGTTGGACGCTGGAAATCGG
GTCAGTCACCTTTCCTGCT
ATGGGTTCCACGTCTTCCTACATGCCTTTGCGTGTTTTGTCTATCCTTCGAGTCGCTAAGCTCATAGAGTTGTATGAAATATCAGGTGCCCCCCTCACTCTTGCGCCGATTGAGGATAAC
TCAAAGCTGATTGGAGCTCAAAACTTCGATTATGCGGACGAGCTGGAGCAACAGCGCTGCCCATACGCTGCCCACGTTAG
GTGATTCTTTTCCTTTTTTTTGTAATCGAACTATCTTTTG
AAATTTACGCCGGCTGTCCAATTCAAAATTTCCTAGAAAAACGAATCCTCGAAAAGGCTTTGCCGGGTTTGAACCCGAAACCGCTGTCTTGCCGCACCTCATGGTCAGAAATGGGATACC
CTACG
GTGAATGATTATGTCTGTTCTTATCTTTTGCAGGTGATTGTGTAATAGACGCGTAAGATTCTCAACCTCCTATGTATCGATTAGGTCCCGAATTGACTAAAGAAGAAATTGAGGA
AAAGCAAACAAAACACAATCGAGGCCTTTTGTTTGTATCTTACCAAAGCAAGATAGAGAACGGGTTCCAGTTTGTACAAAAG
GTCTGTGGATCGAGGCTTCATTTGTCACCCGCTCCAGT
CGGCTTGAGATTGATCTTAGCACTGTCTTCCTGTCGCGCTTGGGAGCGTACTCCTATGGTCAACTTTTGTGCTCATAACACCAGTCTTGGAGTAACAATGTCGACTTCCCCATCAAGAAC
CCTGCAAAGGTGACTCCGGGTTTTGATTTACTCATTGGACAAAGCGGCAATGGAGGTCCTCGCACTGCGCAGAACATTACTTCTAAT
GTTAGTTCACCAGCTTATTCTTCAATCTCCCCT
CTCTTGAAACTTGAGGCTCACCAGAAATAAATTTGTTCTATCAATGCACAAATATACAGGGGATGGCAGGAGAGACTGATCCAAACAACGTCATTACCGCTCCGACCGAGTTCATCAAAA
CCTTGGG
GTGAGTTTCCAGCCAGTAGATATCTTTCCTTGCACAAGGTATTGACAATATCCCCTTTACCCCAATTTTTAGTGGTGAATATTTCTTCTCGCCGTCGATTGAAGCAATCAGAA
CTAAGTTAGGCGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCTCAAACCGTATTCCAATCTACTCCAAGCTCTAACAGCATCGTCGATGCCAATAACGTGCAGGGCGACGTTGTCATTGGACTCATCAAGCGTGTCGAATGTTTTTTGTTTTTG
ACACTGAAGGATGACAATGAGTCTCGACTAGCCTTCCGTCGAACATTGAAAGACAAGCTTCTGCCTCTGATCACCACCACTCAACAAGTCCTCGAAACTCAACGGAAGATAGATGAGAGC
AAACGTCAAACCAAGCCCGGCCAGCCTAAGAAGATCTTACCGATCACTCAGTTCAATATTGCCTTCAGTGCATCTGGATTAAAGAAATTAGGAGTCGGTGATACTGAGATCCCCAGTGAC
AATGCTGCTTTCATTGCCACTCAAAAGTCTGATGCAGTGACGAATCTCGGCGACCCTGTTGATTCAAAGGGTCAAAAGCTCTTGACCTGGTCCCCTGATTTTCTTCAACACTCTATAGAC
GCTGTGATCTTGATTACTGCTCCGGACCAGGAGTCATTATGTCGTAAGATCGACGAAATCAAGACCATCGTTAAAGATTCTATATCTCGTCAATTTTCACGCACTGGAAATGTCCGACCT
GGTTCTGAAGCTGGGCATGAGCATTTTGGCTTTCTG
GATGGTATCTCGACTCCGAAAATCAAGGGCTTCAATTCTACCCAAGCGGACGAGCAAGCCGGCGTTGTAAACCCGAGTGTGATC
TTAGTTGGGCACCCGGATGAAACCAACCCATCAACTACATCACCAGCATGGATGAAAGACGGATCCTTCCTTGCTATACGTGAGCTTCAGCAACTCGTCCCAGAATTTCAAAAGTTCTGT
GATGAGACTGCGAAGAAGAACCCGATCCCCGGTGTCACTGGTGAATTCATTGGTGCGAGAGTCGTTGGACGCTGGAAATCGG
GTGCCCCCCTCACTCTTGCGCCGATTGAGGATAACTCA
AAGCTGATTGGAGCTCAAAACTTCGATTATGCGGACGAGCTGGAGCAACAGCGCTGCCCATACGCTGCCCACGTTAG
AAAAACGAATCCTCGAAAAGGCTTTGCCGGGTTTGAACCCGAA
ACCGCTGTCTTGCCGCACCTCATGGTCAGAAATGGGATACCCTACG
GTCCCGAATTGACTAAAGAAGAAATTGAGGAAAAGCAAACAAAACACAATCGAGGCCTTTTGTTTGTATCTTAC
CAAAGCAAGATAGAGAACGGGTTCCAGTTTGTACAAAAG
TCTTGGAGTAACAATGTCGACTTCCCCATCAAGAACCCTGCAAAGGTGACTCCGGGTTTTGATTTACTCATTGGACAAAGC
GGCAATGGAGGTCCTCGCACTGCGCAGAACATTACTTCTAAT
GGGATGGCAGGAGAGACTGATCCAAACAACGTCATTACCGCTCCGACCGAGTTCATCAAAACCTTGGGTGGTGAATAT
TTCTTCTCGCCGTCGATTGAAGCAATCAGAACTAAGTTAGGCGCTTAG

Retrieve as FASTA