Entry information : MlpDyPrx02
Entry ID 6851
Creation 2009-06-22 (Christophe Dunand)
Last sequence changes 2009-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: MlpDyPrx02
Name MlpDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Melampsoraceae Melampsora
Organism Melampsora laricis-populina    [TaxId: 203908 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MlpDyPrx02
start..stop
S start..stop
MlpDyPrx01 726 0 1..497 1..495
CqueDyPrx01 684 0 1..497 1..491
PgrDyPrx01 575 0 17..496 19..502
PgrDyPrx08 570 0 17..496 19..502
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1000328..1000368 41 N° 2 999644..1000238 595 N° 3 999278..999569 292 N° 4 999082..999196 115
N° 5 998923..999011 89 N° 6 998744..998856 113 N° 7 998517..998639 123 N° 8 998368..998435 68
N° 9 998233..998290 58  
complement(join(998233..998290,998368..998435,998517..998639,998744..998856,9989 23..999011,999082..999196,999278..999569,999644..1000238,1000328..1000368))


exon

Literature and cross-references MlpDyPrx02
DNA ref. JGI genome:   scaffold_18 (1000368..998233)
mRNA ref. JGI transcript:   106559
Protein sequence: MlpDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   497
PWM (Da):   %s   54110.09  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSQTVLSPHSSTSFSVDVNAVQGDVLIGLAKKTEAFVFLTIKDDEDSRLAFRQTLKSKLLPLITTTQQVLDTQRKIEESKYQTKPGEPKKILPITGLNIAFSASGLKKLGVGETEIPEDAKAFIASQKSDAVTNLGDPVDQTGQKLSTWSNEFLQHSIDAVILITAPDHGLLDHKIQEVKHLIHCTTSHTFIRIGVVRPGSEAGHEHFGYDGISKPKIEGFNATEADKKAGVIKPSVILVGQADTQQAKPLDPSQGWMKDGSFLVFRQLQQLVPEFHKFCQDIADKNPQPGVTGEFIGARIVGRWKSGAPLVLAPVEDKPELARVDDFDFSDDLVQQRCPYAAHIRKTNPRDGIEGADPNTAVLPHLITRSGITGPELTPEEVRENKTKHNRGLLFVCYQSKVEDGFQLVQVWSNNPDFPPKNPAKVTAGLDLLIGQNGKPGPRVAQNITSNGTVGDTDPNNIVTADESFVHPLGGEYFFSPSIEAIKSKLGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCAGTCAAACGGTACTTAGCCCACACAGCTCTACTAGGTCATTACTCTTGCGTTCTTTCGTTATCCTCAAGTTGCTTTATATAATAGCTTCTGATGTGTTTCTTTGACCTTACTCG
AAATCTATAGCTTCAGCGTTGATGTCAATGCAGTGCAAGGGGACGTGCTCATCGGCCTGGCCAAGAAAACAGAGGCTTTCGTATTTCTTACCATCAAAGATGATGAAGACTCTCGATTAG
CTTTCCGTCAAACGTTGAAATCCAAGCTCCTGCCTCTGATCACCACCACTCAACAAGTGCTCGACACTCAACGGAAGATAGAGGAGAGCAAATACCAAACCAAGCCTGGCGAGCCTAAAA
AGATCTTACCGATCACTGGATTAAACATAGCATTCAGTGCTTCCGGGCTAAAGAAATTAGGAGTCGGCGAAACGGAGATTCCTGAGGATGCTAAAGCGTTCATCGCCTCGCAAAAGTCTG
ATGCAGTCACGAATCTAGGTGACCCCGTTGACCAAACAGGTCAAAAACTATCAACTTGGTCAAACGAATTTCTTCAACACTCTATCGACGCTGTGATCCTTATCACTGCTCCTGACCACG
GACTGTTAGACCATAAGATCCAAGAGGTAAAGCATTTGATACATTGTACTACTTCCCATACCTTCATTCGCATTGGGGTGGTTCGACCTGGTTCTGAAGCCGGGCATGAGCACTTTGGAT
ATTTG
GTAAGATTGTTTGAATTCCGTTCCAGCTCACAACAAACCTGTTTTCAATGTTGTTGAAAACTCTTTCTGTGTAGGATGGAATCTCGAAGCCTAAGATCGAAGGCTTTAACGCAAC
TGAAGCCGATAAAAAAGCTGGAGTTATAAAGCCAAGCGTCATCTTAGTGGGCCAAGCCGACACTCAACAGGCCAAACCACTTGATCCATCTCAAGGTTGGATGAAAGATGGATCTTTCCT
CGTCTTTCGACAACTACAGCAACTAGTTCCAGAGTTCCATAAGTTTTGTCAAGATATTGCTGACAAGAATCCACAACCTGGTGTGACTGGTGAATTTATTGGTGCTAGAATTGTAGGAAG
ATGGAAATCTG
GTCAGTCAAACAGCGTACTCTGTTTTTGCCTCTTGATTTCTGAAGAGTATAACTAATCCCTTGAACTACGGGTATGATTAGGCGCTCCACTGGTGTTGGCTCCCGTCGA
AGACAAGCCAGAATTAGCCAGAGTAGACGATTTTGACTTCTCAGATGATTTGGTGCAACAAAGATGTCCCTATGCTGCCCATATCAG
GTACGTATGCTTATCGATTCCTCATGATCTTTT
ATAACTTCACTTACTAACAATGGAATCACATAACCAGAAAAACCAACCCTCGTGACGGCATAGAAGGTGCAGACCCGAATACTGCGGTCTTACCTCATCTTATCACTCGTAGTGGTATAA
CCTATG
GTGGATTGCCAACTTTCTAAAGGTCAACTTGACTTTGAAAACTAACGCAATGCTTGATGTTTCTAGGTCCTGAGTTGACTCCAGAAGAAGTCAGAGAGAATAAGACTAAGCACA
ATAGAGGATTACTATTTGTCTGCTACCAAAGCAAGGTGGAGGACGGGTTTCAATTGGTTCAGAAA
GTAAGATCATCAAAACTTGCAATTGTTTAAGTTGAAAATGACATGTATCTTACTT
CTTCTTTTAACTTCCCTATCGTCCAATTTGTTCACAATTTGTTTACAAGGTATGGAGTAACAATCCAGATTTTCCTCCGAAGAACCCAGCAAAAGTGACTGCTGGACTCGACCTTCTTAT
TGGTCAGAATGGAAAACCGGGACCACGTGTTGCTCAAAACATCACGTCGAAT
GTAAAAAAACCACCCCTTTGATACTAAAGTACCTAAAGCTTTCACTCAAGCTCAAGTCATGTTTTTTT
ACTGTTGGAATAGGGTACCGTCGGAGATACAGATCCTAACAATATTGTCACCGCTGATGAATCATTTGTTCATCCTTTAGGGTAAGTCTTATTGAAGCCCACTCTTTTTAAATCATCACT
GATGCAACAACACGTTTTCAATTTCTACTCTTCATCAGCGGCGAGTATTTCTTCTCACCTTCAATTGAAGCTATCAAATCTAAGTTGGGAGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCAGTCAAACGGTACTTAGCCCACACAGCTCTACTAGCTTCAGCGTTGATGTCAATGCAGTGCAAGGGGACGTGCTCATCGGCCTGGCCAAGAAAACAGAGGCTTTCGTATTTCTT
ACCATCAAAGATGATGAAGACTCTCGATTAGCTTTCCGTCAAACGTTGAAATCCAAGCTCCTGCCTCTGATCACCACCACTCAACAAGTGCTCGACACTCAACGGAAGATAGAGGAGAGC
AAATACCAAACCAAGCCTGGCGAGCCTAAAAAGATCTTACCGATCACTGGATTAAACATAGCATTCAGTGCTTCCGGGCTAAAGAAATTAGGAGTCGGCGAAACGGAGATTCCTGAGGAT
GCTAAAGCGTTCATCGCCTCGCAAAAGTCTGATGCAGTCACGAATCTAGGTGACCCCGTTGACCAAACAGGTCAAAAACTATCAACTTGGTCAAACGAATTTCTTCAACACTCTATCGAC
GCTGTGATCCTTATCACTGCTCCTGACCACGGACTGTTAGACCATAAGATCCAAGAGGTAAAGCATTTGATACATTGTACTACTTCCCATACCTTCATTCGCATTGGGGTGGTTCGACCT
GGTTCTGAAGCCGGGCATGAGCACTTTGGATATTTG
GATGGAATCTCGAAGCCTAAGATCGAAGGCTTTAACGCAACTGAAGCCGATAAAAAAGCTGGAGTTATAAAGCCAAGCGTCATC
TTAGTGGGCCAAGCCGACACTCAACAGGCCAAACCACTTGATCCATCTCAAGGTTGGATGAAAGATGGATCTTTCCTCGTCTTTCGACAACTACAGCAACTAGTTCCAGAGTTCCATAAG
TTTTGTCAAGATATTGCTGACAAGAATCCACAACCTGGTGTGACTGGTGAATTTATTGGTGCTAGAATTGTAGGAAGATGGAAATCTG
GCGCTCCACTGGTGTTGGCTCCCGTCGAAGAC
AAGCCAGAATTAGCCAGAGTAGACGATTTTGACTTCTCAGATGATTTGGTGCAACAAAGATGTCCCTATGCTGCCCATATCAG
AAAAACCAACCCTCGTGACGGCATAGAAGGTGCAGAC
CCGAATACTGCGGTCTTACCTCATCTTATCACTCGTAGTGGTATAACCTATG
GTCCTGAGTTGACTCCAGAAGAAGTCAGAGAGAATAAGACTAAGCACAATAGAGGATTACTATTTGTC
TGCTACCAAAGCAAGGTGGAGGACGGGTTTCAATTGGTTCAGAAA
GTATGGAGTAACAATCCAGATTTTCCTCCGAAGAACCCAGCAAAAGTGACTGCTGGACTCGACCTTCTTATTGGT
CAGAATGGAAAACCGGGACCACGTGTTGCTCAAAACATCACGTCGAAT
GGTACCGTCGGAGATACAGATCCTAACAATATTGTCACCGCTGATGAATCATTTGTTCATCCTTTAGGCGGC
GAGTATTTCTTCTCACCTTCAATTGAAGCTATCAAATCTAAGTTGGGAGCTTAA

Retrieve as FASTA