Entry information : Cn1CysPrx01_JEC21
Entry ID 6852
Creation 2009-06-22 (Christophe Dunand)
Last sequence changes 2009-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: Cn1CysPrx01_JEC21
Name Cn1CysPrx01_JEC21
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cn1CysPrx01_JEC21
start..stop
S start..stop
Cn1CysPrx01_grubiiH99 464 2e-169 1..233 1..233
Sre1CysPrx 291 5e-101 3..227 4..217
Um1CysPrx 290 1e-100 3..227 4..217
Pbl1CysPrx01 276 2e-95 1..226 1..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 39721..39786 66 N° 2 39302..39641 340 N° 3 39000..39244 245 N° 4 38883..38933 51
complement(join(38883..38933,39000..39244,39302..39641,39721..39786))


exon

Literature and cross-references Cn1CysPrx01_JEC21
DNA ref. JGI genome:   NC_006680 (39786..38883)
mRNA ref. GenBank:   XM_567781
Protein sequence: Cn1CysPrx01_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   233
PWM (Da):   %s   25831.35  
PI (pH):   %s   5.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRLGDIAPDFEADTTHGRIKFHDWLDGSWAILFSHPDDFTPVCTTELSAVALSYADFASRGVKLIGLSANNIASHEGWIKDINALKPDAPALEFPIIGDEDRTVSELYGMLDKLDKTNVDKKGIPFTVRTVFVIDPKKQIRLTLAYPASTGRNFPELLRVIDSLQLGDKHRITTPANWGIPDPKTGQVEERVIVHPSVQGEEVKQLFGDDVETVPYLRFTSNPSKKEVTA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11, 3 introns). Strain="JEC21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCCGACTTGGTGATATTGCCCCCGACTTTGAGGCGGATACTACGCACGGCCGCATCAAAGTGAGTTCAAATTCCCCCATCCCATTTCTCGCTCGTTCGCTCGCTCGCTTCCTC
GGCAACTGACCAGCTTTTGTGACAGTTCCACGACTGGCTCGACGGCTCGTGGGCCATCCTCTTCTCCCACCCTGACGACTTCACCCCCGTCTGCACCACGGAGCTTTCAGCCGTTGCTCT
CTCTTACGCCGATTTCGCCTCGCGGGGTGTCAAGCTCATCGGTCTTTCCGCGAACAATATTGCCTCGCACGAAGGGTGGATCAAGGATATCAATGCGTTGAAGCCTGATGCCCCTGCGTT
GGAGTTTCCGATTATAGGGGACGAGGACAGGACAGTGTCAGAGTTGTATGGGATGCTGGATAAGCTTGATAAGACGAATGTGGATAAGAAGGGGATACCGTTTACGGTCAGGACTGTTTT
CGTCA
GTAAGTATCAACAACAGTACATATTTGTTATGGCCTGTGCTGATAAAATGTACATAGTCGACCCAAAGAAACAGATCCGCCTCACCCTCGCTTATCCCGCGTCTACAGGCCGCAA
CTTTCCCGAACTCTTGCGTGTCATTGACTCTCTCCAGCTGGGCGACAAGCACCGTATCACCACGCCTGCCAACTGGGGGATTCCCGATCCCAAGACCGGGCAGGTCGAGGAGAGGGTTAT
CGTCCACCCGTCTGTACAGGGCGAGGAGGTGAAGCAGTTGTTTGGAGATGATGTTGAGACTGTTTAT
GTGAGTCATGGTCGTTGTGCATTGGGCGTGGGCTTGGGACGGTACGGTGCTGA
TACGTTTTGGTAGCCTTACCTCCGCTTTACATCCAACCCTTCCAAGAAGGAGGTCACGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCCGACTTGGTGATATTGCCCCCGACTTTGAGGCGGATACTACGCACGGCCGCATCAAATTCCACGACTGGCTCGACGGCTCGTGGGCCATCCTCTTCTCCCACCCTGACGAC
TTCACCCCCGTCTGCACCACGGAGCTTTCAGCCGTTGCTCTCTCTTACGCCGATTTCGCCTCGCGGGGTGTCAAGCTCATCGGTCTTTCCGCGAACAATATTGCCTCGCACGAAGGGTGG
ATCAAGGATATCAATGCGTTGAAGCCTGATGCCCCTGCGTTGGAGTTTCCGATTATAGGGGACGAGGACAGGACAGTGTCAGAGTTGTATGGGATGCTGGATAAGCTTGATAAGACGAAT
GTGGATAAGAAGGGGATACCGTTTACGGTCAGGACTGTTTTCGTCA
TCGACCCAAAGAAACAGATCCGCCTCACCCTCGCTTATCCCGCGTCTACAGGCCGCAACTTTCCCGAACTCTTG
CGTGTCATTGACTCTCTCCAGCTGGGCGACAAGCACCGTATCACCACGCCTGCCAACTGGGGGATTCCCGATCCCAAGACCGGGCAGGTCGAGGAGAGGGTTATCGTCCACCCGTCTGTA
CAGGGCGAGGAGGTGAAGCAGTTGTTTGGAGATGATGTTGAGACTGTTTAT
CCTTACCTCCGCTTTACATCCAACCCTTCCAAGAAGGAGGTCACGGCTTAA

Retrieve as FASTA