Entry information : Cn2CysPrx01_JEC21
Entry ID 6853
Creation 2009-06-22 (Christophe Dunand)
Last sequence changes 2012-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-23 (Christophe Dunand)
Peroxidase information: Cn2CysPrx01_JEC21
Name Cn2CysPrx01_JEC21
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cn2CysPrx01_JEC21
start..stop
S start..stop
Cn2CysPrx01_H99 404 2e-146 1..197 1..197
Slut2CysPrx01 256 6e-88 9..195 5..193
Sbre2CysPrx01 256 8e-88 9..195 5..193
Athi2CysPrx01 254 3e-87 9..195 5..193
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 302569..302609 41 N° 2 302349..302420 72 N° 3 302261..302286 26 N° 4 302168..302178 11
N° 5 301943..302107 165 N° 6 301609..301887 279  
complement(join(301609..301887,301943..302107,302168..302178,302261..302286,3023 49..302420,302569..302609))


exon

Literature and cross-references Cn2CysPrx01_JEC21
DNA ref. JGI genome:   NC_006692 (302609..301609)
mRNA ref. GenBank:   XM_571871
Protein sequence: Cn2CysPrx01_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197
PWM (Da):   %s   21503.87  
PI (pH):   %s   4.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATYTLPQIQKPAPNFAGTAVKEGSFEEIKLNDFKGKWTILVFYPGLHLVCPTEILAFNKALDQFAAVGAEVICVSTDSEFTHLAWSQTKRSEGGLGPDLKLTLADRNHAAAKAYGVLLPEEGVALRGTFFIDPKGTLRAMHVHDLPVGRSVEETIRVIKAFQFTDEHGEVCPAGWEEGKDTIDTSAPSAYFSKQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTACACTCTTCCCCAAATCCAGAAGCCCGCACCGTGAGTATACACTTTCCACTTTATGGGGTGTTGGATGTCATTCGGCCCGTTCGGCCGACTGCGCCTCCCGCCCAGACGT
ACCCAGTGGCATCCTGCTTTCCCATACTTTTTCCATACACTGATCATCCTGCTGACTGCCCATCTGTAGCAACTTTGCCGGTACCGCCGTCAAGGAGGGTTCTTTCGAGGAGATCAAGCT
CAATGACTTCAAGGGCAAGTG
GTGAGTCTACTTTCTGGTCCTTATCTATCGAAGCATCCCGCTTACTCATGTTTTTTTCGCAGGACTATCCTTGTCTTCTACCCCATGGTAAGTTTAGTT
GTTTGCCCCTAGTCCAGTTTGCAGTTTCTCACGTTCGTTTTTGTCCTGTTTTGGTTTGGTTTATCATATAGGACTTCACCTGTAAGTCTTGGCATATCTTCGGCTTATCCCTGCAGCTCG
CTGACTGTACCATTTTGTAGTCGTTTGCCCTACTGAGATCCTTGCCTTTAACAAGGCCCTCGACCAGTTCGCCGCTGTTGGTGCCGAGGTCATCTGTGTCTCCACCGACTCTGAATTCAC
CCACCTTGCCTGGTCTCAGACCAAGAGGAGCGAGGGTGGTCTTGGCCCTGACCTGAAGTTGACTTTG
GTGAGTTCCTTCCTACTTTAATATCTTGTCTTCAGTGATTGACCACAAGTCAC
AGCTCGCCGACCGAAACCATGCCGCTGCCAAGGCCTACGGTGTCCTTCTCCCGGAGGAGGGTGTCGCCCTCCGAGGCACTTTCTTCATTGACCCTAAGGGTACCCTCCGCGCCATGCACG
TTCACGACCTTCCCGTCGGCCGATCCGTCGAGGAGACCATCCGTGTCATCAAGGCCTTCCAGTTCACCGACGAGCACGGTGAGGTCTGCCCAGCCGGCTGGGAGGAGGGCAAGGACACCA
TCGACACCTCCGCGCCCTCTGCTTACTTCTCGAAGCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCTACACTCTTCCCCAAATCCAGAAGCCCGCACCCAACTTTGCCGGTACCGCCGTCAAGGAGGGTTCTTTCGAGGAGATCAAGCTCAATGACTTCAAGGGCAAGTGGACTATC
CTTGTCTTCTACCCCATGG
GACTTCACCTGGTTTGCCCTACTGAGATCCTTGCCTTTAACAAGGCCCTCGACCAGTTCGCCGCTGTTGGTGCCGAGGTCATCTGTGTCTCCACCGACTCT
GAATTCACCCACCTTGCCTGGTCTCAGACCAAGAGGAGCGAGGGTGGTCTTGGCCCTGACCTGAAGTTGACTTTG
CTCGCCGACCGAAACCATGCCGCTGCCAAGGCCTACGGTGTCCTT
CTCCCGGAGGAGGGTGTCGCCCTCCGAGGCACTTTCTTCATTGACCCTAAGGGTACCCTCCGCGCCATGCACGTTCACGACCTTCCCGTCGGCCGATCCGTCGAGGAGACCATCCGTGTC
ATCAAGGCCTTCCAGTTCACCGACGAGCACGGTGAGGTCTGCCCAGCCGGCTGGGAGGAGGGCAAGGACACCATCGACACCTCCGCGCCCTCTGCTTACTTCTCGAAGCAGTAA

Retrieve as FASTA