Entry information : CnPrxV_JEC21
Entry ID 6854
Creation 2009-06-22 (Christophe Dunand)
Last sequence changes 2009-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: CnPrxV_JEC21
Name CnPrxV_JEC21
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnPrxV_JEC21
start..stop
S start..stop
CnPrxV_grubiiH99 405 2e-146 1..224 1..224
AthiPrxV 151 1e-46 42..224 2..178
AmusPrxV 150 2e-46 42..224 2..181
SbrePrxV01 149 1e-45 65..224 25..178
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1150293..1150351 59 N° 2 1150408..1150472 65 N° 3 1150552..1150732 181 N° 4 1150821..1150999 179
N° 5 1151085..1151234 150 N° 6 1151338..1151378 41  
join(1150293..1150351,1150408..1150472,1150552..1150732,1150821..1150999,1151085 ..1151234,1151338..1151378)


exon

Literature and cross-references CnPrxV_JEC21
DNA ref. JGI genome:   NC_006693 (1150293..1151378)
mRNA ref. GenBank:   XM_572206
Protein sequence: CnPrxV_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   23463.43  
PI (pH):   %s   9.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRIATTTARAIPARAVATRSIMTLRRVAVPQASPKGYRSSILQDTAKTAHSAFANLASAAPIKKGDKMPDVEIKIDGPEGKVNLGKEKGKNVVVLVPGAFSGVCSNQVPPYITSFSDFKAKGINNVYVVAVNDIFVVNAWKDKMIGEFSSKEGEGVKAADDTAALASALGLTFDAQPVFGGPRLKRGVLVVNDGVVEYVGVEDSPGDITISAADKVIKQL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTCAGAATCGCAACCACCACAGCCAGGGCTATCCCAGCAAGGGCCGTAGCCACGTGAGTCGGCTGTGTGGCGGACCCGGAACTACCACGCTCATTTCTATTCCATTTAGACGAT
CAATCATGACTCTCAGGAGAGTCGCCGTCCCACAGGCCTCTCCTAAAGGCTACAGGCAAT
GTACGTATTTCTGGCCCATTGTGTGACGGGAAGAAGCAGAATTCCTCACTGACATTTGGA
CGCTCGGATCTTTGACCAGCATCCATCCTCCAAGACACAGCCAAAACAGCCCATTCGGCCTTTGCCAACCTCGCTTCCGCCGCGCCTATCAAAAAGGGGGATAAGATGCCGGACGTAGAG
ATCAAGATTGATGGCCCTGAGGGGAAAGTGAACTTGGGCAAGGAAAAGGGGAAAAATGTGGTCGTTTTAGTTCCTGGAGC
GTAAGTCCAAGTCCATTCCGATCATTCGAGTATCCGAATG
TTTGAGTGTTTAAAAGGTGCGAAAGCTGAGCTTTATGTGACGATGCAGATTCTCGGGCGTCTGCTCAAACCAAGTCCCGCCTTACATTACCTCTTTCTCCGATTTCAAAGCCAAAGGGAT
CAACAATGTCTACGTCGTAGCAGTGAATGATATCTTTGTGGTGAACGCTTGGAAAGACAAGATGATTGGGGAGTTTAGCTCCAAAGAGGGGGAGGGAGTCAAGTTTG
GTAAGTCAATCTC
TCCGAACGGGATTGTTTCCTTAAACGAGGAGGTACTGATATGATTTTTTTAATCTTTTTCCAATGCTGTTAGCCGCCGACGACACTGCTGCCCTCGCCTCGGCCCTTGGCCTCACCTTCG
ATGCCCAACCCGTGTTTGGTGGACCGCGGCTCAAGCGCGGCGTGTTGGTCGTTAATGATGGGGTGGTAGAGTATGTCGGTGTGGAGGATAGTCCTGGTGATA
GTACGTATCATCTCTTTC
TTTTTTTTCTTCGTACCCTGTCCTTAATGAAAATTTGGATTGAGAATCGAAGGGTCGGAAGCTGATTTTGCATTGTATCATGTAGTCACCATCTCTGCTGCTGATAAAGTCATTAAGCAA
CTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTCAGAATCGCAACCACCACAGCCAGGGCTATCCCAGCAAGGGCCGTAGCCACACGATCAATCATGACTCTCAGGAGAGTCGCCGTCCCACAGGCCTCTCCTAAAGGCTACAGG
CAAT
CATCCATCCTCCAAGACACAGCCAAAACAGCCCATTCGGCCTTTGCCAACCTCGCTTCCGCCGCGCCTATCAAAAAGGGGGATAAGATGCCGGACGTAGAGATCAAGATTGATGGC
CCTGAGGGGAAAGTGAACTTGGGCAAGGAAAAGGGGAAAAATGTGGTCGTTTTAGTTCCTGGAGC
ATTCTCGGGCGTCTGCTCAAACCAAGTCCCGCCTTACATTACCTCTTTCTCCGAT
TTCAAAGCCAAAGGGATCAACAATGTCTACGTCGTAGCAGTGAATGATATCTTTGTGGTGAACGCTTGGAAAGACAAGATGATTGGGGAGTTTAGCTCCAAAGAGGGGGAGGGAGTCAAG
TTTG
CCGCCGACGACACTGCTGCCCTCGCCTCGGCCCTTGGCCTCACCTTCGATGCCCAACCCGTGTTTGGTGGACCGCGGCTCAAGCGCGGCGTGTTGGTCGTTAATGATGGGGTGGTA
GAGTATGTCGGTGTGGAGGATAGTCCTGGTGATA
TCACCATCTCTGCTGCTGATAAAGTCATTAAGCAACTTTAA

Retrieve as FASTA