Entry information : CnPrxQ_JEC21
Entry ID 6855
Creation 2009-06-22 (Christophe Dunand)
Last sequence changes 2009-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: CnPrxQ_JEC21
Name CnPrxQ_JEC21
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer Abscission
Repressor N/D
Best BLASTp hits
Perox score E-value CnPrxQ_JEC21
start..stop
S start..stop
CnPrxQ_grubiiH99 304 5e-108 1..167 1..167
LbiPrxQ02 164 5e-52 11..162 69..222
PcPrxQ02 162 2e-51 19..153 85..217
AthiPrxQ 159 8e-50 19..162 101..242
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1421598..1421765 168 N° 2 1421822..1421941 120 N° 3 1421993..1422057 65 N° 4 1422116..1422142 27
N° 5 1422201..1422281 81 N° 6 1422336..1422378 43  
join(1421598..1421765,1421822..1421941,1421993..1422057,1422116..1422142,1422201 ..1422281,1422336..1422378)


exon

Literature and cross-references CnPrxQ_JEC21
DNA ref. JGI genome:   NC_006685 (1421598..1422378)
mRNA ref. GenBank:   XM_569732.1
Cluster/Prediction ref. UniGene:   Fne.7089
Protein sequence: CnPrxQ_JEC21
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18614.29  
PI (pH):   %s   4.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPDEDSEEREDEEDGEVLKMGDRLPSIKLEDEEGNTVDVSTLAGEKGVVFFLYPKADTPGCTNQACGYRDMFEEIAVFGYEIYGLSKDTPTAQQKWKAKKSLNYHLLSDPKSKLIKRLGAFVPPKNTKRSHFIFEKGTGNLIDIDIGVRPAEDPNNVVGFLTEKYL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 5 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCCTGATGAAGATAGTGAAGAACGAGAGGACGAAGAGGATGGCGAGGTGTTGAAGATGGGAGATAGGCTTCCAAGCATCAAGTTGGAGGATGAGGAGGGGAACACGGTTGATGTT
TCAACATTGGCCGGTGAAAAGGGCGTTGTGTTCTTCTTGTACCCCAAG
GTGGGCCCATCGTTGGATAGAAGTAAAAAATATATCATTTACTGACATAATTCAAGGCCGACACACCAGGAT
GTACTAATCAAGCATGCGGGTACAGAGACATGTTCGAAGAAATCGCAGTATTTGGTTATGAGATTTATGGACTCTCAAAAGACACTCCGACGGCACAACAAAAG
GTACTCAAAATTGGTG
CTGTTCTGTCAAGCCCAGGGCTGATATAATTACAGTGGAAAGCCAAAAAATCTCTCAACTACCATCTTCTCAGTGATCCCAAGAGCAAACTGATCAAAAGGTTAGTCCTTGACCTCCATC
CAACATCATCCTCGCTCATTTTTTCGATACCTCATTAGGCTGGGTGCATTCGTTCCTCCCAAAAAGTCAGTGCTTCTGGCAATGCAATGCCTGGCTTCTATATGCTGACAGTCAAATATA
TAGCACCAAGCGTTCTCACTTCATCTTCGAGAAGGGAACGGGCAATCTCATCGACATTGATATCGGCGTCAGGCCCGCAGAAGAGTAAGTTTAATTCATCAAAAAGGCTAAGACAATTTG
ACTAATTTGATCCGATAGTCCCAACAATGTTGTCGGGTTCTTAACTGAGAAATATTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCCTGATGAAGATAGTGAAGAACGAGAGGACGAAGAGGATGGCGAGGTGTTGAAGATGGGAGATAGGCTTCCAAGCATCAAGTTGGAGGATGAGGAGGGGAACACGGTTGATGTT
TCAACATTGGCCGGTGAAAAGGGCGTTGTGTTCTTCTTGTACCCCAAG
GCCGACACACCAGGATGTACTAATCAAGCATGCGGGTACAGAGACATGTTCGAAGAAATCGCAGTATTTGGT
TATGAGATTTATGGACTCTCAAAAGACACTCCGACGGCACAACAAAAG
TGGAAAGCCAAAAAATCTCTCAACTACCATCTTCTCAGTGATCCCAAGAGCAAACTGATCAAAAGGCTGGGT
GCATTCGTTCCTCCCAAAAA
CACCAAGCGTTCTCACTTCATCTTCGAGAAGGGAACGGGCAATCTCATCGACATTGATATCGGCGTCAGGCCCGCAGAAGATCCCAACAATGTTGTCGGG
TTCTTAACTGAGAAATATTTATAA

Retrieve as FASTA