Entry information : AvePrx112-1C
Entry ID 6865
Creation 2009-07-13 (Ester Simonetti)
Last sequence changes 2012-05-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-09 (Christophe Dunand)
Peroxidase information: AvePrx112-1C
Name AvePrx112-1C
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Aegilops
Organism Aegilops ventricosa (Goatgrass) (Triticum ventricosum)    [TaxId: 116981 ]
Cellular localisation N/D
Tissue type Roots
Inducer Cyst nematode infection
Repressor N/D
Best BLASTp hits
Perox score E-value AvePrx112-1C
start..stop
S start..stop
TaPrx02-1D 638 0 1..314 1..314
TmPrx03 595 0 1..314 1..314
AvePrx112-1M 595 0 1..314 1..314
TaPrx112-1A 593 0 1..314 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168..377 210 N° 2 486..662 177 N° 3 806..1363 558  
join(168..377,486..662,806..1363)


exon

Literature and cross-references AvePrx112-1C
Literature Simonetti,E., Veronico,P., Melillo,M.T., Delibes,A., Andres,M.F. and Lopez-Brana,I. Analysis of Class III Peroxidase Genes Expressed in Roots of Resistant and Susceptible Wheat Lines Infected by Heterodera avenae. Mol. Plant Microbe Interact. 22 (9), 1081-1092 (2009).
DNA ref. GenBank:   EU567314.1
Protein sequence: AvePrx112-1C
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (291)
PWM (Da):   %s   32501.14 (30397.1)  
PI (pH):   %s   8.15 (8.21) Peptide Signal:   %s   cut: 24 range:24-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMGSASCISLVVLVALATAASGQLSSTFYDTSCPRALVAIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLTGMEQNAGPNVGSLRGFGVIDNIKTQLESVCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSTTASASLANSDLPGPSSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYGGDTNINTAFATSLKANCPQSGGNTNLANLDTMTPNAFDNAYYTNLLSQKGLLHSDQVLFNNETTDNTVRNFASNAAAFSSAFTTAMIKMGNIAPLTGTQGQIRLSCSKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGGTTCTGCCTCTTGCATTTCTCTGGTGGTGCTCGTGGCTCTGGCCACGGCGGCGTCCGGGCAGCTGTCGTCGACGTTCTACGACACGTCGTGCCCCAGGGCTCTGGTCGCC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGATCCCCGCATGGGCGCGTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GCAAGTTTCACATAATATATCAGCTCTTTT
TCCCTTGACCAACTTTCTTGAACTGCCTGGATTTAACAAAATTTATATTCCGGACTAATACGTTTATGTTGGCTACAGGGCTGTGACGCATCTGTTCTTCTGACTGGCATGGAACAAAAC
GCGGGTCCGAACGTGGGGTCGCTGAGGGGCTTCGGCGTCATCGACAACATCAAGACCCAGCTGGAGAGTGTATGCAAGCAGACCGTCTCCTGCGCCGACATCCTCACCGTCGCCGCCCGC
GACTCCGTTGTCGCC
GTAAGAACATCTTAGTACTACACTCATTTACATGATCGATGCTACCTGAAGGATAGAACATATATCCCCTCCGATTCATATAAATTGTCGCTGATTTAGTACATA
CTTAATTTCCTACTTGGTCTGCTATCTTTCACATACAGCTTGGAGGGCCATCGTGGACTGTCCCGCTGGGGAGACGGGATTCCACCACCGCAAGTGCCTCGCTGGCGAACAGTGACCTCC
CTGGCCCGAGCTCTAGCCGGTCACAGCTCGAGGCCGCGTTCCTCAAGAAGAACCTTAACACGGTCGACATGGTCGCGCTCTCAGGCGCGCACACCATCGGGAAGGCCCAGTGCTCCAACT
TCCGGACTCGGATCTACGGCGGTGACACCAACATCAACACTGCCTTCGCGACGTCTCTCAAGGCCAACTGCCCCCAGTCCGGCGGCAACACCAACCTGGCGAACCTGGACACGATGACGC
CCAATGCGTTCGACAACGCCTACTACACCAACCTCCTGTCACAGAAAGGGCTCCTGCACTCGGACCAGGTGCTCTTCAACAACGAGACCACCGACAACACTGTCCGCAACTTTGCGTCCA
ACGCGGCGGCCTTCAGCAGCGCCTTCACGACGGCCATGATCAAGATGGGAAACATCGCGCCGCTCACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGGTTCTGCCTCTTGCATTTCTCTGGTGGTGCTCGTGGCTCTGGCCACGGCGGCGTCCGGGCAGCTGTCGTCGACGTTCTACGACACGTCGTGCCCCAGGGCTCTGGTCGCC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGATCCCCGCATGGGCGCGTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GGCTGTGACGCATCTGTTCTTCTGACTGGC
ATGGAACAAAACGCGGGTCCGAACGTGGGGTCGCTGAGGGGCTTCGGCGTCATCGACAACATCAAGACCCAGCTGGAGAGTGTATGCAAGCAGACCGTCTCCTGCGCCGACATCCTCACC
GTCGCCGCCCGCGACTCCGTTGTCGCC
CTTGGAGGGCCATCGTGGACTGTCCCGCTGGGGAGACGGGATTCCACCACCGCAAGTGCCTCGCTGGCGAACAGTGACCTCCCTGGCCCGAGC
TCTAGCCGGTCACAGCTCGAGGCCGCGTTCCTCAAGAAGAACCTTAACACGGTCGACATGGTCGCGCTCTCAGGCGCGCACACCATCGGGAAGGCCCAGTGCTCCAACTTCCGGACTCGG
ATCTACGGCGGTGACACCAACATCAACACTGCCTTCGCGACGTCTCTCAAGGCCAACTGCCCCCAGTCCGGCGGCAACACCAACCTGGCGAACCTGGACACGATGACGCCCAATGCGTTC
GACAACGCCTACTACACCAACCTCCTGTCACAGAAAGGGCTCCTGCACTCGGACCAGGTGCTCTTCAACAACGAGACCACCGACAACACTGTCCGCAACTTTGCGTCCAACGCGGCGGCC
TTCAGCAGCGCCTTCACGACGGCCATGATCAAGATGGGAAACATCGCGCCGCTCACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA