Entry information : AvePrx113-1B
Entry ID 6870
Creation 2009-07-13 (ester Simonetti)
Last sequence changes 2014-06-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-18 (Christophe Dunand)
Peroxidase information: AvePrx113-1B
Name AvePrx113-1B
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Aegilops
Organism Aegilops ventricosa (Goatgrass) (Triticum ventricosum)    [TaxId: 116981 ]
Cellular localisation N/D
Tissue type Roots
Inducer Cyst nematode infection
Repressor N/D
Best BLASTp hits
Perox score E-value AvePrx113-1B
start..stop
S start..stop
TaPrx113-1B 644 0 1..316 1..316
TmPrx02 640 0 1..316 1..316
AvePrx113-1F 637 0 1..316 1..316
HvPrx11 609 0 3..316 2..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 101..307 207 N° 2 411..587 177 N° 3 695..1261 567  
join(101..307,411..587,695..1261)


exon

Literature and cross-references AvePrx113-1B
Literature Simonetti,E., Veronico,P., Melillo,M.T., Delibes,A., Andres,M.F. and Lopez-Brana,I. Analysis of Class III Peroxidase Genes Expressed in Roots of Resistant and Susceptible Wheat Lines Infected by Heterodera avenae. Mol. Plant Microbe Interact. 22 (9), 1081-1092 (2009).
DNA ref. GenBank:   EU595577.1
Protein sequence: AvePrx113-1B
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   32770.06 (30783.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.1 (6.10) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASASCISLVVLVALATAASGQLSPTFYDTSCPRALATIKSGVMAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQNAIPNAGSLRGFGVIDSIKTQIEAICNQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSIDANEAEANSDLPGFNSSRSELEAAFLRKGGLNTVDMVAPSGAHTIGQAQCSTFRARIYGGDTNINAAYAASLRANCPQTVGSGDGSLANLDTTTPNAFDNAYYTNLMSQRGLLHSDQVLFNNDTTDNTVRNFASNPAAFSSAFTTAMIKMGNIAPKTGTQGQIRLSCSRVNS*

Retrieve as FASTA  
Remarks Complete sequence fom genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCAGCGTCCTGCATTTCTCTGGTGGTGCTCGTGGCTCTGGCCACGGCGGCGTCGGGGCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCCAGGGCTCTGGCCACCATC
AAGAGCGGCGTCATGGCCGCCGTGAGCAGCGACCCTCGGATGGGCGCGTCACTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAA
GTAAGTTGGCCACATGCATGCATGGCCTGATAG
CCGTCACGTACCCGGTTTTCTATCGGTTTTGCTTGCTGAATGCTGAACACTATGCGTATGTGATGTGCAGGGCTGCGACGCGTCTGTTCTGCTGTCTGGCATGGAACAAAACGCTATCCC
GAACGCGGGGTCGCTGAGGGGCTTCGGCGTCATCGACAGCATCAAGACGCAGATCGAGGCCATCTGCAATCAGACCGTCTCTTGCGCTGACATCCTCACCGTCGCCGCCCGCGACTCCGT
CGTCGCC
GTAAGAGTATCATCTTACGATCATGTAGATCATCGACTGGATGCTCGGCATCTTTTACACCATCGTTAACCGTTTGTTTGCCTTTTGTTTGAATTCTTCGCGTGCAGCTCGGG
GGGCCGTCATGGACAGTCCCTTTGGGGAGAAGAGATTCCATAGATGCAAACGAGGCAGAGGCAAACAGCGACCTTCCAGGCTTTAATTCTAGCCGCTCAGAGCTCGAGGCAGCATTCCTC
AGGAAGGGCGGACTCAATACGGTCGACATGGTGGCCCCCTCGGGCGCGCACACCATCGGCCAGGCGCAGTGCTCGACCTTCCGGGCTCGGATCTACGGCGGTGACACCAACATCAATGCG
GCCTATGCGGCGTCGCTTAGGGCCAACTGCCCCCAGACAGTCGGCTCCGGTGACGGCAGCCTGGCGAACCTGGACACGACGACCCCCAACGCGTTCGACAACGCCTACTACACCAACCTC
ATGTCACAGAGGGGGCTCCTGCACTCGGACCAGGTGCTGTTCAACAACGACACCACTGACAACACTGTCCGGAACTTCGCTTCGAACCCGGCAGCGTTCAGCAGCGCCTTCACGACCGCC
ATGATCAAGATGGGCAACATCGCGCCGAAGACAGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAGGGTGAACTCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCAGCGTCCTGCATTTCTCTGGTGGTGCTCGTGGCTCTGGCCACGGCGGCGTCGGGGCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCCAGGGCTCTGGCCACCATC
AAGAGCGGCGTCATGGCCGCCGTGAGCAGCGACCCTCGGATGGGCGCGTCACTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAA
GGCTGCGACGCGTCTGTTCTGCTGTCTGGCATG
GAACAAAACGCTATCCCGAACGCGGGGTCGCTGAGGGGCTTCGGCGTCATCGACAGCATCAAGACGCAGATCGAGGCCATCTGCAATCAGACCGTCTCTTGCGCTGACATCCTCACCGTC
GCCGCCCGCGACTCCGTCGTCGCC
CTCGGGGGGCCGTCATGGACAGTCCCTTTGGGGAGAAGAGATTCCATAGATGCAAACGAGGCAGAGGCAAACAGCGACCTTCCAGGCTTTAATTCT
AGCCGCTCAGAGCTCGAGGCAGCATTCCTCAGGAAGGGCGGACTCAATACGGTCGACATGGTGGCCCCCTCGGGCGCGCACACCATCGGCCAGGCGCAGTGCTCGACCTTCCGGGCTCGG
ATCTACGGCGGTGACACCAACATCAATGCGGCCTATGCGGCGTCGCTTAGGGCCAACTGCCCCCAGACAGTCGGCTCCGGTGACGGCAGCCTGGCGAACCTGGACACGACGACCCCCAAC
GCGTTCGACAACGCCTACTACACCAACCTCATGTCACAGAGGGGGCTCCTGCACTCGGACCAGGTGCTGTTCAACAACGACACCACTGACAACACTGTCCGGAACTTCGCTTCGAACCCG
GCAGCGTTCAGCAGCGCCTTCACGACCGCCATGATCAAGATGGGCAACATCGCGCCGAAGACAGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAGGGTGAACTCATAA

Retrieve as FASTA