Entry information : AvePrx114-1B
Entry ID 6873
Creation 2009-07-13 (ester Simonetti)
Last sequence changes 2012-05-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-09 (Christophe Dunand)
Peroxidase information: AvePrx114-1B
Name AvePrx114-1B
Class Class III peroxidase    [Orthogroup: Prx079]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Aegilops
Organism Aegilops ventricosa (Goatgrass) (Triticum ventricosum)    [TaxId: 116981 ]
Cellular localisation N/D
Tissue type Roots
Inducer Cyst nematode infection
Repressor N/D
Best BLASTp hits
Perox score E-value AvePrx114-1B
start..stop
S start..stop
AvePrx114-1C 637 0 1..321 1..321
TaPrx114-1A 542 0 1..321 1..319
AvePrx114-1A 542 0 1..321 1..319
HvPrx33 507 0 47..321 1..275
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 65..280 216 N° 2 666..857 192 N° 3 950..1507 558  
join(65..280,666..857,950..1507)


exon

Literature and cross-references AvePrx114-1B
Literature Simonetti,E., Veronico,P., Melillo,M.T., Delibes,A., Andres,M.F. and Lopez-Brana,I. Analysis of Class III Peroxidase Genes Expressed in Roots of Resistant and Susceptible Wheat Lines Infected by Heterodera avenae. Mol. Plant Microbe Interact. 22 (9), 1081-1092 (2009).
DNA ref. GenBank:   EU595580.1
Protein sequence: AvePrx114-1B
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   33441.77 (31241.6)  
PI (pH):   %s   8.65 (8.76) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMAMAPSLSVLLLLCLAAAASASPPLSPQFYAKSCPRALATIKSAVTAAVRSEPRMGASLLRLHFHDCFVQGCDASVLLSDTATFTGEQGAAPNARSIRGMNVIDNIKAQVEAVCRQTVSCADILAVAARDSVVALGGPSWTVPLGRRDSTTASLSLANSDLPAPSFDLANLTANFAAKGLSVTDMVALSGGHTIGQSQCRFFRSRLYNETNIDAAFATSLKANCPRTTSSGNSSLAPLDTTTPNGFDNAYYSNLMSQKGLLHSDQVLINDGRTAGLVRTYSSASAQFNRDFAAAMVRMGNISPLTGAQGQIRLSCSRVN*

Retrieve as FASTA  
Remarks complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGGCAATGGCTCCTTCTCTGTCGGTGCTGTTGCTCCTGTGCCTAGCAGCGGCCGCCTCGGCGTCGCCGCCGCTTTCCCCTCAGTTCTACGCCAAGTCGTGCCCCAGGGCGCTG
GCAACCATCAAGAGTGCCGTGACCGCCGCCGTGAGGAGTGAGCCCCGCATGGGAGCGTCGCTGCTCCGGCTGCATTTCCACGACTGCTTTGTCCAA
GCAAGTCCCTCTCATCTATCGTGT
CCCTTTACTTACTACTCTCGTACTTTTATATTGCATATATTACTGCTTGTACTTAATTTAGTAGGTCTCCTAGTCCTAGATCGACCAGTTAATCACACTGTCTTCAGAGTCATTGCAGTA
TCAAAAAGCTAGTGGAATGGAAAACTGCATATATATGTAGGAGTATCACAAGTTGACTCCAGTCCATGCATGCATGGCCATTCTAATTAATCTGACTTTTCAACTCTTTTTTTACAGTGA
CTTTTCAACATTCTTCAGTTCAAATCAATTATAACAGAATTAGAAATTTATGTAGGAGTACTACTACTGAATTTATCTTGACGGAAGAAATTTCTTATGTGCGTGACGCATGATGCATCA
GGGCTGCGATGCGTCCGTGCTGCTGAGCGACACGGCCACCTTCACCGGCGAGCAGGGGGCAGCTCCCAACGCCCGCTCCATTCGAGGCATGAACGTCATCGACAACATCAAGGCGCAGGT
CGAGGCCGTGTGCAGGCAGACTGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGTGACTCCGTCGTCGCC
GTAAGATCGACCAGGCCGTGTACATGCAGTTAATTTGCTGAACGCAC
GCGACAGTAAATTAAGTGACTTGGTTCTTTACTAATCGCTTGCAGCTGGGAGGGCCTTCGTGGACCGTTCCTCTGGGGAGGAGGGACTCCACGACGGCGAGCCTTTCGCTGGCGAACAGC
GACCTGCCTGCACCGTCCTTCGACCTCGCCAACCTCACCGCCAACTTCGCCGCCAAGGGGCTCAGCGTGACCGACATGGTCGCCCTCTCTGGCGGCCACACGATCGGACAATCGCAGTGC
CGGTTTTTCAGGAGCAGGCTCTACAACGAGACCAACATCGACGCGGCCTTCGCGACATCTCTCAAGGCCAACTGCCCCCGGACGACCAGCTCCGGCAACAGCAGCCTGGCGCCGCTGGAC
ACGACGACGCCCAACGGGTTCGACAACGCATACTACAGCAACCTGATGTCCCAGAAGGGGCTCCTGCACTCCGACCAGGTGCTGATCAACGACGGACGCACCGCCGGCCTGGTCCGGACG
TACTCGTCGGCGTCGGCACAGTTCAACAGGGACTTCGCGGCGGCCATGGTGAGGATGGGGAACATCAGCCCGCTCACCGGGGCGCAGGGGCAGATCAGGCTCAGCTGCTCCAGGGTGAAC
TAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGGCAATGGCTCCTTCTCTGTCGGTGCTGTTGCTCCTGTGCCTAGCAGCGGCCGCCTCGGCGTCGCCGCCGCTTTCCCCTCAGTTCTACGCCAAGTCGTGCCCCAGGGCGCTG
GCAACCATCAAGAGTGCCGTGACCGCCGCCGTGAGGAGTGAGCCCCGCATGGGAGCGTCGCTGCTCCGGCTGCATTTCCACGACTGCTTTGTCCAA
GGCTGCGATGCGTCCGTGCTGCTG
AGCGACACGGCCACCTTCACCGGCGAGCAGGGGGCAGCTCCCAACGCCCGCTCCATTCGAGGCATGAACGTCATCGACAACATCAAGGCGCAGGTCGAGGCCGTGTGCAGGCAGACTGTC
TCCTGCGCCGACATCCTCGCCGTCGCCGCCCGTGACTCCGTCGTCGCC
CTGGGAGGGCCTTCGTGGACCGTTCCTCTGGGGAGGAGGGACTCCACGACGGCGAGCCTTTCGCTGGCGAAC
AGCGACCTGCCTGCACCGTCCTTCGACCTCGCCAACCTCACCGCCAACTTCGCCGCCAAGGGGCTCAGCGTGACCGACATGGTCGCCCTCTCTGGCGGCCACACGATCGGACAATCGCAG
TGCCGGTTTTTCAGGAGCAGGCTCTACAACGAGACCAACATCGACGCGGCCTTCGCGACATCTCTCAAGGCCAACTGCCCCCGGACGACCAGCTCCGGCAACAGCAGCCTGGCGCCGCTG
GACACGACGACGCCCAACGGGTTCGACAACGCATACTACAGCAACCTGATGTCCCAGAAGGGGCTCCTGCACTCCGACCAGGTGCTGATCAACGACGGACGCACCGCCGGCCTGGTCCGG
ACGTACTCGTCGGCGTCGGCACAGTTCAACAGGGACTTCGCGGCGGCCATGGTGAGGATGGGGAACATCAGCCCGCTCACCGGGGCGCAGGGGCAGATCAGGCTCAGCTGCTCCAGGGTG
AACTAA

Retrieve as FASTA