Entry information : AvePrx108 (Prx108)
Entry ID 6875
Creation 2009-07-14 (Ester Simonetti)
Last sequence changes 2014-06-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-06-18 (Christophe Dunand)
Peroxidase information: AvePrx108 (Prx108)
Name (synonym) AvePrx108 (Prx108)
Class Class III peroxidase    [Orthogroup: Prx059]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Aegilops
Organism Aegilops ventricosa (Goatgrass) (Triticum ventricosum)    [TaxId: 116981 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AvePrx108
start..stop
S start..stop
TaPrx20-1B 640 0 1..313 1..313
TmPrx04 631 0 1..313 1..313
TaPrx20-1A 589 0 1..312 1..312
HvPrx29 559 0 21..313 21..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 55..255 201 N° 2 387..563 177 N° 3 656..1219 564  
join(55..255,387..563,656..1219)


exon

Literature and cross-references AvePrx108 (Prx108)
Literature Simonetti,E., Veronico,P., Melillo,M.T., Delibes,A., Andres,M.F. and Lopez-Brana,I. Analysis of Class III Peroxidase Genes Expressed in Roots of Resistant and Susceptible Wheat Lines Infected by Heterodera avenae. Mol. Plant Microbe Interact. 22 (9), 1081-1092 (2009).
DNA ref. GenBank:   EU595582.1
Protein sequence: AvePrx108 (Prx108)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (293)
PWM (Da):   %s   32832.11 (30973.1)  
PI (pH):   %s   6.49 (6.49) Peptide Signal:   %s   cut: 21 range:21-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSLSAVLLLCLAVAASAQLSPTFYDTTCPNALATIKSAVTAAVNKENRMGASLLRLHFHDCFVQGCDASVLLSGMEQNAFPNVMSLRGFEVIDSIKAKLETMCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSTNANEAVANSDLPPPFFDLVNLTQSFGDKGFTVTDMVALSGAHTIGQAQCQNFRDRLYNETNINSGFATSLKANCPQPTGSGDRNLANLDVSTPYSFDNAYYSNLKSQKGLLHSDQVLFTGTGGGTDNTVNNFASNPAAFSSAFASAMVKMGNLSPLTGSQGQVRLSCSKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCGTCTCTATCAGCCGTGTTGCTCTTGTGCCTGGCCGTGGCGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGACGTGCCCGAACGCTCTGGCGACCATCAAGTCC
GCCGTGACGGCCGCCGTGAACAAGGAGAACCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAA
GTAAGCTCTTCAAATACATAGCCTGATAGTCGGCACGTT
CCCTGTTTTCATTCCGGTTTTGTTTGTTAAACACTAGGGTCCATAGTTATCCATGCATGCTTCCTGACTATGCTGCTTAACTACATGTGCAGGGTTGTGACGCGTCTGTTCTGCTGTCTG
GCATGGAACAAAACGCTTTCCCGAACGTGATGTCGCTGCGAGGCTTCGAAGTCATCGACAGCATCAAGGCAAAGCTCGAGACCATGTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCA
CCGTCGCTGCCCGCGACTCTGTCGTCGCC
GTAAGACCTCCAACCTGTGTCACGTCATGATCACCACCAAGTAGACCGGCTAATTTGCTCACCCTGGATATTTGTTTCGTCCTCTGGTACA
GTTAGGAGGGCCTTCGTGGACGGTTCCTCTTGGAAGGAGGGACTCCACCAATGCAAACGAAGCCGTGGCGAACTCTGACCTACCTCCCCCATTCTTTGACCTCGTTAACCTCACCCAATC
CTTCGGCGACAAAGGCTTCACCGTGACCGACATGGTCGCCCTCTCGGGCGCCCACACCATCGGGCAGGCGCAGTGCCAGAACTTCAGGGACAGACTCTACAACGAGACCAACATCAACTC
CGGCTTCGCGACGTCGCTCAAGGCCAACTGCCCCCAGCCGACCGGCTCCGGCGACCGCAACCTGGCCAATCTGGACGTGTCGACCCCGTACTCCTTCGACAACGCCTACTACAGCAACCT
CAAGTCCCAGAAGGGTCTCCTGCACTCCGACCAGGTGCTCTTCACCGGCACCGGCGGCGGCACCGACAACACGGTCAACAACTTCGCAAGCAACCCAGCGGCGTTCAGCAGCGCCTTCGC
CTCAGCCATGGTGAAGATGGGGAACCTCAGCCCATTGACTGGCTCTCAGGGGCAGGTCAGGCTCAGCTGCTCAAAGGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCGTCTCTATCAGCCGTGTTGCTCTTGTGCCTGGCCGTGGCGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGACGTGCCCGAACGCTCTGGCGACCATCAAGTCC
GCCGTGACGGCCGCCGTGAACAAGGAGAACCGCATGGGCGCGTCGCTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAA
GGTTGTGACGCGTCTGTTCTGCTGTCTGGCATGGAACAA
AACGCTTTCCCGAACGTGATGTCGCTGCGAGGCTTCGAAGTCATCGACAGCATCAAGGCAAAGCTCGAGACCATGTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCACCGTCGCTGCC
CGCGACTCTGTCGTCGCC
TTAGGAGGGCCTTCGTGGACGGTTCCTCTTGGAAGGAGGGACTCCACCAATGCAAACGAAGCCGTGGCGAACTCTGACCTACCTCCCCCATTCTTTGACCTC
GTTAACCTCACCCAATCCTTCGGCGACAAAGGCTTCACCGTGACCGACATGGTCGCCCTCTCGGGCGCCCACACCATCGGGCAGGCGCAGTGCCAGAACTTCAGGGACAGACTCTACAAC
GAGACCAACATCAACTCCGGCTTCGCGACGTCGCTCAAGGCCAACTGCCCCCAGCCGACCGGCTCCGGCGACCGCAACCTGGCCAATCTGGACGTGTCGACCCCGTACTCCTTCGACAAC
GCCTACTACAGCAACCTCAAGTCCCAGAAGGGTCTCCTGCACTCCGACCAGGTGCTCTTCACCGGCACCGGCGGCGGCACCGACAACACGGTCAACAACTTCGCAAGCAACCCAGCGGCG
TTCAGCAGCGCCTTCGCCTCAGCCATGGTGAAGATGGGGAACCTCAGCCCATTGACTGGCTCTCAGGGGCAGGTCAGGCTCAGCTGCTCAAAGGTGAATTAA

Retrieve as FASTA