Entry information : PpaPrx[P]50 ( PP00146G00260)
Entry ID 6950
Creation 2009-08-18 (Christophe Dunand)
Last sequence changes 2012-01-05 (Toky Ramarohetra)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-17 (Christophe Dunand)
Peroxidase information: PpaPrx[P]50 ( PP00146G00260)
Name (synonym) PpaPrx[P]50 ( PP00146G00260)
Class Class III peroxidase     [Orthogroup: Prx040]*
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx[P]50
start..stop
S start..stop
PpaPrx02 264 1e-89 1..191 1..192
PpaPrx36 213 1e-69 1..191 1..192
PpaPrx52 191 5e-61 1..189 1..189
PpaPrx06 191 5e-61 1..189 1..189
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 784918..785136 219 N° 2 785368..785721 354  
join(784918..785136,785368..785721)


exon

Literature and cross-references PpaPrx[P]50 ( PP00146G00260)
DNA ref. Phytozome 12:   scaffold_146 (784918..785721)
Protein sequence: PpaPrx[P]50 ( PP00146G00260)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   189 (162)
PWM (Da):   %s   20797.87 (17973.2)  
PI (pH):   %s   8.49 (8.49) Peptide Signal:   %s   cut: 28 range:28-189
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAHILRALSVLALILVALSLGVREVDAQLQYGLYR*SCPRAEKIVLEEI*RYFKRDPTIAPGLLRLTFHDCFVGCDASVRFVGRNTERASHMNARLHGFRVIDIAKHCLEKACLRTESCADFLAYASRNAVVLTGGKCWQVVAGRRDGRISNKIELEQNIPPPTAGVDELVSTFAQKGLNTQDMVDLSGIY

Retrieve as FASTA  
Remarks Partial sequence from genomic. Stop in the sequence and last exon is partial. Last part is in reverse orientation. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACACATTCTAAGAGCCTTGTCAGTTTTGGCCTTGATACTCGTTGCATTATCCTTGGGAGTCCGTGAGGTGGACGCTCAGCTTCAGTACGGCTTATACAGGTAATCATGTCCTCGA
GCAGAAAAAATCGTACTCGAGGAGATCTAGAGATACTTTAAGAGGGACCCGACCATCGCTCCAGGACTGCTACGCTTGACATTCCACGACTGTTTCGTT
TGCGTAAGCACCGCACGTCTA
GCCTCAAAGCACCATCTGGTTTCGTGATGCCTCAGTAACTGCAATGCCATATGTTCATTCTAGATTTCATGACAAGCGATGAGGCGTGCCATGAAATTCTGAATCAGTTTCACACTAAAG
ACTAGTTTGTGATTTCTTCTGTGCATGAATAAGATAGAATTTGGAATGAGTTGCATTGTAGCCATCTACGGGCCTGAATCTTGTTCGGAGGGTTGCGACGCATCAGTTCGTTTTGTCGGG
AGAAACACTGAACGAGCGTCTCATATGAACGCCAGGTTGCATGGATTCCGAGTAATTGACATAGCCAAGCACTGCCTAGAGAAGGCTTGTCTCAGAACCGAGTCGTGTGCTGATTTTTTG
GCGTATGCCTCCCGCAACGCAGTTGTACTGACCGGTGGAAAGTGCTGGCAGGTTGTCGCAGGACGGAGAGATGGAAGAATCTCGAATAAAATCGAGCTCGAACAGAACATTCCTCCGCCC
ACCGCCGGGGTCGATGAGCTCGTTTCCACATTCGCACAGAAGGGACTGAACACGCAAGACATGGTTGACTTGTCTGGTATATAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACACATTCTAAGAGCCTTGTCAGTTTTGGCCTTGATACTCGTTGCATTATCCTTGGGAGTCCGTGAGGTGGACGCTCAGCTTCAGTACGGCTTATACAGGTAATCATGTCCTCGA
GCAGAAAAAATCGTACTCGAGGAGATCTAGAGATACTTTAAGAGGGACCCGACCATCGCTCCAGGACTGCTACGCTTGACATTCCACGACTGTTTCGTT
GGTTGCGACGCATCAGTTCGT
TTTGTCGGGAGAAACACTGAACGAGCGTCTCATATGAACGCCAGGTTGCATGGATTCCGAGTAATTGACATAGCCAAGCACTGCCTAGAGAAGGCTTGTCTCAGAACCGAGTCGTGTGCT
GATTTTTTGGCGTATGCCTCCCGCAACGCAGTTGTACTGACCGGTGGAAAGTGCTGGCAGGTTGTCGCAGGACGGAGAGATGGAAGAATCTCGAATAAAATCGAGCTCGAACAGAACATT
CCTCCGCCCACCGCCGGGGTCGATGAGCTCGTTTCCACATTCGCACAGAAGGGACTGAACACGCAAGACATGGTTGACTTGTCTGGTATATAT

Retrieve as FASTA