Entry information : SmPrx35-2_170 (SmPrx35b_170)
Entry ID 7001
Creation 2009-10-02 (Paula Nunes)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx35-2_170 (SmPrx35b_170)
Name (synonym) SmPrx35-2_170 (SmPrx35b_170)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx35-2_170
start..stop
S start..stop
SmPrx35-1_84 669 0 1..328 1..328
SmPrx10-2_25 383 3e-134 8..328 4..323
SmPrx10-1_3 382 6e-134 8..328 4..323
SmPrx70-1_38 357 7e-124 11..328 7..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58717..58935 219 N° 2 59007..59201 195 N° 3 59270..59435 166 N° 4 59500..59906 407
join(58717..58935,59007..59201,59270..59435,59500..59906)


exon

Literature and cross-references SmPrx35-2_170 (SmPrx35b_170)
DNA ref. Phytozome 12:   scaffold_170 (58717..59906)
mRNA ref. JGI transcript:   137572 [Incorrect splicing]
Protein sequence: SmPrx35-2_170 (SmPrx35b_170)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (303)
PWM (Da):   %s   34867.77 (32168.2)  
PI (pH):   %s   7.22 (7.68) Peptide Signal:   %s   cut: 26 range:26-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLPLLLLLECIVLISLPRLGSIDAQKIQVGFYSTTCPQAESIVKNVVSSAVSANRGLAAGLLRLQFHDCFVQGCDASVLIDSTPSTKGGAEKDAPPNKTLRGFEVIDAAKAQVEAKCPGTVSCADILAFATRDAVVQVGGPRWDVPAGRRDGRISSAAEATSSLPDPSFSINQLTQRFAAKGLSQDNMITLSGAHTIGVAHCKTFINRLYGFSSSADTDPSLDPTFAQSLKAQCPRENPNPNTVVSLDPTPNTFDNSYYSNLALGRGLLASDELLFTDGSTTLNVALNSFFGSTWLQKFPDAMVKMSLIEVKTGSQGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Incorrect transcript prediction from JGI (incorrect splicing intron 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGCCACTGCTGCTGCTACTCGAATGCATTGTCTTGATTTCGCTGCCGCGACTGGGCAGCATTGATGCGCAGAAAATCCAAGTTGGATTCTACTCCACGACGTGTCCGCAGGCC
GAATCAATCGTCAAGAATGTGGTCAGCAGCGCGGTGTCGGCCAACCGAGGATTGGCCGCTGGACTTCTTCGCTTGCAATTCCACGACTGCTTCGTCCAG
GTTGCCAAACTTCTCCCAGTT
TCTTATACTGAGCTTCCTCTGTTGTCTCACTTCTCCTCCTGGATGGTCAGGGATGCGATGCTTCCGTGCTGATTGATTCCACGCCGAGCACCAAAGGTGGAGCCGAGAAGGACGCCCCGC
CAAACAAGACGCTCCGGGGGTTCGAGGTGATTGACGCCGCAAAGGCGCAGGTCGAGGCAAAGTGCCCGGGAACAGTCTCGTGCGCGGACATTCTCGCGTTTGCCACGCGCGATGCAGTCG
TCCAG
GTCGATCGATTGCTAAGTTTGCTGGAGAGAATCGACAGAAACTCAATCGCGTTTTTCTTGTGCCACAGGTTGGAGGGCCGCGCTGGGACGTTCCCGCGGGACGACGAGACGGGCG
AATCTCCTCGGCAGCCGAGGCTACGTCCAGCTTGCCCGACCCTTCTTTCTCCATCAATCAGCTCACACAGCGCTTCGCTGCCAAAGGCCTCTCGCAAGACAACATGATAACTCTCTCAG
G
CAAGACACACCATCTTTCTTCCTTCCAGTGTTTCCATCGAGAATCCATAGCTTCATCTTTCAGGAGCTCACACCATCGGAGTGGCACACTGCAAGACTTTCATCAACCGGCTGTATGGAT
TCAGCAGCAGTGCCGACACGGACCCTTCTCTCGATCCAACCTTCGCGCAGAGCCTCAAAGCCCAATGCCCGCGAGAGAATCCCAATCCCAACACCGTCGTCAGCCTCGACCCCACGCCCA
ACACCTTCGACAACAGCTACTACTCCAACCTCGCGCTGGGCAGGGGATTGCTCGCCTCGGACGAGCTCCTCTTCACGGACGGATCCACGACGCTCAATGTGGCTCTCAATTCCTTCTTTG
GATCAACTTGGCTCCAGAAATTCCCCGACGCGATGGTGAAGATGAGCCTCATCGAAGTCAAGACGGGGAGCCAAGGCGAGATCCGGAAGAACTGCCGGAGGATCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGCCACTGCTGCTGCTACTCGAATGCATTGTCTTGATTTCGCTGCCGCGACTGGGCAGCATTGATGCGCAGAAAATCCAAGTTGGATTCTACTCCACGACGTGTCCGCAGGCC
GAATCAATCGTCAAGAATGTGGTCAGCAGCGCGGTGTCGGCCAACCGAGGATTGGCCGCTGGACTTCTTCGCTTGCAATTCCACGACTGCTTCGTCCAG
GGATGCGATGCTTCCGTGCTG
ATTGATTCCACGCCGAGCACCAAAGGTGGAGCCGAGAAGGACGCCCCGCCAAACAAGACGCTCCGGGGGTTCGAGGTGATTGACGCCGCAAAGGCGCAGGTCGAGGCAAAGTGCCCGGGA
ACAGTCTCGTGCGCGGACATTCTCGCGTTTGCCACGCGCGATGCAGTCGTCCAG
GTTGGAGGGCCGCGCTGGGACGTTCCCGCGGGACGACGAGACGGGCGAATCTCCTCGGCAGCCGAG
GCTACGTCCAGCTTGCCCGACCCTTCTTTCTCCATCAATCAGCTCACACAGCGCTTCGCTGCCAAAGGCCTCTCGCAAGACAACATGATAACTCTCTCAG
GAGCTCACACCATCGGAGTG
GCACACTGCAAGACTTTCATCAACCGGCTGTATGGATTCAGCAGCAGTGCCGACACGGACCCTTCTCTCGATCCAACCTTCGCGCAGAGCCTCAAAGCCCAATGCCCGCGAGAGAATCCC
AATCCCAACACCGTCGTCAGCCTCGACCCCACGCCCAACACCTTCGACAACAGCTACTACTCCAACCTCGCGCTGGGCAGGGGATTGCTCGCCTCGGACGAGCTCCTCTTCACGGACGGA
TCCACGACGCTCAATGTGGCTCTCAATTCCTTCTTTGGATCAACTTGGCTCCAGAAATTCCCCGACGCGATGGTGAAGATGAGCCTCATCGAAGTCAAGACGGGGAGCCAAGGCGAGATC
CGGAAGAACTGCCGGAGGATCAACTAG

Retrieve as FASTA