Entry information : SmPrx54-2_1 (SmPrx54b_1)
Entry ID 7014
Creation 2009-10-07 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx54-2_1 (SmPrx54b_1)
Name (synonym) SmPrx54-2_1 (SmPrx54b_1)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx54-2_1
start..stop
S start..stop
SmPrx54-1_5 662 0 1..331 1..331
SmPrx59-1_19 380 4e-133 29..330 31..332
PabPrx86 378 3e-132 28..330 24..327
SmPrx59-2_61 378 3e-132 29..330 32..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4671502..4671723 222 N° 2 4671233..4671427 195 N° 3 4671012..4671177 166 N° 4 4670314..4670726 413
complement(join(4670314..4670726,4671012..4671177,4671233..4671427,4671502..4671 723))


exon

Literature and cross-references SmPrx54-2_1 (SmPrx54b_1)
DNA ref. Phytozome 11:   scaffold_1 (4671723..4670314)
mRNA ref. JGI transcript:   403769
Protein sequence: SmPrx54-2_1 (SmPrx54b_1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (310)
PWM (Da):   %s   34988.93 (32808.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.99 (7.31) Peptide Signal:   %s   cut: 22 range:22-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRSSALLSIFLAVAPVLIVAEIAISPRLATDFYVRSCPELPSIVRRVIAAKFAQTPVAAAGTLRIFFHDCMVEGCDASVLVASTPSNKAEKDAEVNLSLPGDGFDAVIKAKAAVESKCPGVVSCADILALSTRELVVLIGGPSWEVRLGRRDGTVSKASRVPGNLPMPNMTVAELTSLFASKGLSLQDMVALTGGGHTAGFAHCNQFMDRIYGTIDSTMNPSYAAELRQACPRGPSLDPTLVTHLDPSTPDLFDNAFFKNTLYGRGLLRSDQALFSTSNSSARPLVNLFAGSQPRFFEAFAVAMDKLGGIGVKTGGQGEIRRDCAAFNHA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGGAGCAGTGCACTGCTTTCAATCTTTCTCGCAGTTGCTCCGGTGCTCATCGTCGCCGAGATCGCGATTTCCCCTCGCCTCGCCACTGACTTCTACGTGAGATCCTGCCCGGAG
CTCCCTAGCATTGTGCGGCGCGTCATTGCGGCCAAGTTTGCGCAGACGCCAGTGGCCGCGGCTGGGACGCTGCGGATCTTCTTCCACGATTGCATGGTTGAG
GTAAAACAGCCTTGCGGA
TCGTTCCTGTTCTTGGCTTGGCGCATTCTAAAAGCTTAACTTTGTTTCTTCGAAAGGGGTGTGATGCCTCAGTGCTAGTCGCGTCCACTCCGAGCAACAAGGCTGAGAAGGATGCCGAGG
TCAACCTCTCCTTGCCTGGCGATGGATTTGACGCGGTGATCAAGGCCAAGGCCGCGGTGGAATCAAAGTGCCCCGGCGTTGTCTCCTGTGCCGACATTCTTGCTTTGAGCACCCGAGAGC
TCGTCGTCCTG
GTAAGAAACTGAGAGACAACATCTTCAAGTTCGCAAAGCTTCCGTTTTTCTACAGATTGGAGGGCCCTCTTGGGAAGTTCGTCTTGGTCGGAGAGATGGCACGGTCTCG
AAAGCTTCCAGAGTTCCTGGAAATCTCCCCATGCCAAACATGACAGTGGCGGAGCTAACTTCGCTCTTCGCCTCCAAAGGCCTCTCTCTCCAGGACATGGTGGCGCTCACCG
GTATGAAC
TCCTTCCCTTTCACTCCAATCCTATACCTGATATCATACGCTCAAGACAATTCAAAGCTTCTCAGAACATTTGCCTTTTTTTTTCCAAGCATTTTTTCCTCGCTCCGTGCTAGTCAATCG
AGAGATCATTCACGCTTGGGTTAGCATCCATACATCCCGGAACAATAAAACCATTCCCACGATCTTACATGACATAAATTCTTTCTCTACATTCTTGTACTGCTGACACCTGCAGTCCTC
GATCGATCGATCGATGGATGCATTTATTCCATCCCAGGAGGAGGCCACACCGCTGGATTCGCGCACTGCAACCAATTCATGGACCGCATTTATGGAACCATCGATTCCACCATGAATCCC
TCCTACGCCGCCGAGCTCCGCCAGGCGTGCCCGAGGGGCCCGAGTCTGGATCCAACCCTGGTCACGCACCTCGACCCCTCCACGCCCGACCTCTTCGACAACGCCTTCTTCAAGAACACA
CTGTACGGGCGAGGATTGCTGCGCTCCGACCAGGCCCTCTTCTCCACCTCCAACTCTTCCGCGAGGCCGCTCGTCAATCTCTTTGCTGGATCGCAGCCGCGATTCTTCGAGGCGTTCGCC
GTCGCCATGGACAAGCTCGGCGGCATTGGCGTCAAGACGGGAGGACAGGGAGAGATCCGCCGGGATTGCGCTGCCTTCAACCATGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGGAGCAGTGCACTGCTTTCAATCTTTCTCGCAGTTGCTCCGGTGCTCATCGTCGCCGAGATCGCGATTTCCCCTCGCCTCGCCACTGACTTCTACGTGAGATCCTGCCCGGAG
CTCCCTAGCATTGTGCGGCGCGTCATTGCGGCCAAGTTTGCGCAGACGCCAGTGGCCGCGGCTGGGACGCTGCGGATCTTCTTCCACGATTGCATGGTTGAG
GGGTGTGATGCCTCAGTG
CTAGTCGCGTCCACTCCGAGCAACAAGGCTGAGAAGGATGCCGAGGTCAACCTCTCCTTGCCTGGCGATGGATTTGACGCGGTGATCAAGGCCAAGGCCGCGGTGGAATCAAAGTGCCCC
GGCGTTGTCTCCTGTGCCGACATTCTTGCTTTGAGCACCCGAGAGCTCGTCGTCCTG
ATTGGAGGGCCCTCTTGGGAAGTTCGTCTTGGTCGGAGAGATGGCACGGTCTCGAAAGCTTCC
AGAGTTCCTGGAAATCTCCCCATGCCAAACATGACAGTGGCGGAGCTAACTTCGCTCTTCGCCTCCAAAGGCCTCTCTCTCCAGGACATGGTGGCGCTCACCG
GAGGAGGCCACACCGCT
GGATTCGCGCACTGCAACCAATTCATGGACCGCATTTATGGAACCATCGATTCCACCATGAATCCCTCCTACGCCGCCGAGCTCCGCCAGGCGTGCCCGAGGGGCCCGAGTCTGGATCCA
ACCCTGGTCACGCACCTCGACCCCTCCACGCCCGACCTCTTCGACAACGCCTTCTTCAAGAACACACTGTACGGGCGAGGATTGCTGCGCTCCGACCAGGCCCTCTTCTCCACCTCCAAC
TCTTCCGCGAGGCCGCTCGTCAATCTCTTTGCTGGATCGCAGCCGCGATTCTTCGAGGCGTTCGCCGTCGCCATGGACAAGCTCGGCGGCATTGGCGTCAAGACGGGAGGACAGGGAGAG
ATCCGCCGGGATTGCGCTGCCTTCAACCATGCCTGA

Retrieve as FASTA