Entry information : SmPrx70-1_38 (SmPrx70a_38)
Entry ID 7046
Creation 2009-10-18 (Paula Nunes)
Last sequence changes 2009-10-18 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx70-1_38 (SmPrx70a_38)
Name (synonym) SmPrx70-1_38 (SmPrx70a_38)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx70-1_38
start..stop
S start..stop
SmPrx70-2_63 667 0 1..326 1..326
SmPrx10-2_25 369 7e-129 4..326 1..323
SmPrx10-1_3 369 2e-128 4..326 1..323
SmPrx35-1_84 357 6e-124 7..326 11..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 831318..831524 207 N° 2 831583..831771 189 N° 3 831851..832016 166 N° 4 832079..832497 419
join(831318..831524,831583..831771,831851..832016,832079..832497)


exon

Literature and cross-references SmPrx70-1_38 (SmPrx70a_38)
DNA ref. Phytozome 12:   scaffold_38 (831318..832497)
mRNA ref. JGI transcript:   177154
EST ref. GenBank:   FE454031.1 [3' end]
Protein sequence: SmPrx70-1_38 (SmPrx70a_38)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (304)
PWM (Da):   %s   35469.88 (33008.6)  
PI (pH):   %s   6.87 (6.51) Peptide Signal:   %s   cut: 23 range:23-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSMSFCFVVVVFLALAEISRCELRLGFYADSCPEAESVVQFTVAQAVATNPGIAAGLLRLHFHDCFVRGCDGSVLIDSTGNNKAEKDAIPNFGLRGFEVIDNAKARLEDRCPGTVSCADILTYAARDAVSQVGGPRWDVLGGRRDGTVSRADQVGANLPSPLFNVDQLTKSFVRKGMTQEEMITLSGAHTIGIAHCLSFVNRLYNFSTTSVQDPDLDPNMARLLKSLCPKGSDFLDPKSKSIALDPLSPNLFDNGYYTSLSLRRSILTSDQILFADLDTRDSVEDKQANEAVWRFKFVNAMVKMSTIGVLSGNQGRIRTNCRVVS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCCATGAGCTTTTGCTTCGTCGTCGTCGTGTTTCTTGCGCTCGCGGAGATCTCACGCTGCGAGTTGAGGCTGGGTTTTTATGCCGACTCGTGCCCCGAGGCCGAGTCCGTCGTC
CAGTTCACGGTGGCTCAGGCAGTCGCGACTAATCCTGGAATCGCTGCTGGGCTTCTACGTCTTCACTTCCACGATTGCTTTGTCCGG
GTAAGCTTTGGTTTTGATTCTTTTCTCGAGCTT
CTCTCATGATCTCCACCTTTGGCAGGGATGCGATGGCTCGGTTCTCATCGATTCTACCGGGAACAACAAGGCCGAGAAGGATGCGATTCCAAACTTCGGTCTTCGTGGATTCGAAGTCAT
TGACAATGCAAAGGCTCGGCTCGAGGATCGGTGTCCTGGAACAGTGTCTTGTGCTGATATACTCACGTACGCTGCTCGCGACGCCGTCTCACAG
GTATAGAATGAAAAAAAAAGTGATTT
TTTGTTGTAGTTTTCTTCAGGAGCTTGCGTAAACTGGTGGTTTTGAAACACAGGTTGGTGGACCTCGCTGGGACGTCCTCGGTGGAAGAAGAGATGGAACCGTGTCTCGAGCAGACCAAG
TCGGCGCAAATCTTCCATCGCCGCTGTTCAACGTCGATCAACTGACCAAGAGTTTTGTTCGCAAAGGAATGACACAGGAAGAGATGATCACTCTCTCAG
GTGAAAATTTCCATCATGCTT
ATCTCTCAATCGCCAAAAAGTTTGTTTTTACTCCATCGTAGGAGCTCACACGATTGGAATCGCGCATTGCCTCTCCTTCGTCAACAGGTTGTATAACTTCAGCACCACCTCGGTCCAGGA
CCCCGACTTGGATCCAAACATGGCCAGACTTCTCAAATCTCTGTGTCCCAAAGGTAGCGACTTCCTGGATCCTAAAAGCAAATCCATAGCTCTCGACCCTCTCTCTCCCAACTTGTTCGA
CAATGGCTACTACACATCGCTCAGCCTTCGCAGGAGCATACTCACGTCGGACCAGATCTTGTTCGCGGACTTGGACACTCGAGACAGTGTCGAGGACAAGCAGGCCAACGAGGCGGTTTG
GAGGTTTAAGTTCGTGAATGCAATGGTAAAGATGAGCACCATCGGTGTGCTCTCTGGTAACCAGGGGCGAATCCGCACGAACTGTAGAGTAGTTTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCCATGAGCTTTTGCTTCGTCGTCGTCGTGTTTCTTGCGCTCGCGGAGATCTCACGCTGCGAGTTGAGGCTGGGTTTTTATGCCGACTCGTGCCCCGAGGCCGAGTCCGTCGTC
CAGTTCACGGTGGCTCAGGCAGTCGCGACTAATCCTGGAATCGCTGCTGGGCTTCTACGTCTTCACTTCCACGATTGCTTTGTCCGG
GGATGCGATGGCTCGGTTCTCATCGATTCTACC
GGGAACAACAAGGCCGAGAAGGATGCGATTCCAAACTTCGGTCTTCGTGGATTCGAAGTCATTGACAATGCAAAGGCTCGGCTCGAGGATCGGTGTCCTGGAACAGTGTCTTGTGCTGAT
ATACTCACGTACGCTGCTCGCGACGCCGTCTCACAG
GTTGGTGGACCTCGCTGGGACGTCCTCGGTGGAAGAAGAGATGGAACCGTGTCTCGAGCAGACCAAGTCGGCGCAAATCTTCCA
TCGCCGCTGTTCAACGTCGATCAACTGACCAAGAGTTTTGTTCGCAAAGGAATGACACAGGAAGAGATGATCACTCTCTCAG
GAGCTCACACGATTGGAATCGCGCATTGCCTCTCCTTC
GTCAACAGGTTGTATAACTTCAGCACCACCTCGGTCCAGGACCCCGACTTGGATCCAAACATGGCCAGACTTCTCAAATCTCTGTGTCCCAAAGGTAGCGACTTCCTGGATCCTAAAAGC
AAATCCATAGCTCTCGACCCTCTCTCTCCCAACTTGTTCGACAATGGCTACTACACATCGCTCAGCCTTCGCAGGAGCATACTCACGTCGGACCAGATCTTGTTCGCGGACTTGGACACT
CGAGACAGTGTCGAGGACAAGCAGGCCAACGAGGCGGTTTGGAGGTTTAAGTTCGTGAATGCAATGGTAAAGATGAGCACCATCGGTGTGCTCTCTGGTAACCAGGGGCGAATCCGCACG
AACTGTAGAGTAGTTTCTTGA

Retrieve as FASTA