Entry information : SmPrx80-1_13 (SmPrx80a_13)
Entry ID 7081
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2009-10-22 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx80-1_13 (SmPrx80a_13)
Name (synonym) SmPrx80-1_13 (SmPrx80a_13)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx80-1_13
start..stop
S start..stop
SmPrx80-2_66 650 0 7..327 1..321
GbPrx49 391 3e-137 6..327 18..344
GbPrx29 389 3e-136 9..327 5..328
ApuncPrx29 385 5e-135 27..327 32..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2107704..2107916 213 N° 2 2107420..2107614 195 N° 3 2107142..2107307 166 N° 4 2106652..2107061 410
complement(join(2106652..2107061,2107142..2107307,2107420..2107614,2107704..2107 916))


exon

Literature and cross-references SmPrx80-1_13 (SmPrx80a_13)
DNA ref. Phytozome 12:   scaffold_13 (2107916..2106652)
mRNA ref. JGI transcript:   231472
Protein sequence: SmPrx80-1_13 (SmPrx80a_13)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (301)
PWM (Da):   %s   35704.12 (32710.6) Transmb domain:   %s   i12-34o
PI (pH):   %s   9.61 (9.79) Peptide Signal:   %s   cut: 27 range:27-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFRYDFMDKTLLLLLVITVCVFSSSAQLSVGFYGRTCPRVESIVKRVALDKFKQAPTSAAATVRLFFHDCFGCDASVTLASTPANRAEKDADINKSLAGDAFDSVMKAKKAVEAECPGVVSCADVLAILTRDFVGLTGGPTWQVKKGRRDGRISRAEAATANLPGAEFSVNQLLKNFATKGLNLVDLVSLSGAHTFGFAHCDQFSSRLYNFSSSNRMDPTMSSSFASDLKKSCPIRGGNPNLVEPFDPVTPFEFDNAYYKNLLAGRGLVTSDQELYSDRRTRKLVRLFSKKRQRFFNAFADAMDKMGSIGVKTGTSGEIRRDCSRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCGCTACGATTTCATGGATAAAACATTGCTACTTTTGCTAGTGATTACAGTTTGCGTTTTCTCTTCCTCGGCCCAACTCTCGGTTGGCTTCTACGGCAGGACCTGCCCGCGAGTG
GAATCCATCGTCAAGCGAGTAGCTCTCGACAAATTTAAGCAAGCACCAACATCTGCCGCTGCCACAGTCCGTCTCTTCTTCCACGACTGCTTC
GTCGAGGCAAGTCGAGAGAAAAAAATC
TAGTGTTTTTTTCTCTCATCCCTGATAAACTTGTCCGGATTTCCATGAATTCCTCCATCCAGGGGTGTGATGCTTCCGTGACCTTAGCATCCACGCCGGCAAACAGAGCCGAGAAGGACG
CGGACATCAACAAATCCCTGGCCGGAGACGCGTTTGATTCGGTGATGAAAGCCAAGAAAGCCGTGGAAGCCGAGTGCCCGGGAGTGGTCTCTTGCGCCGATGTTCTCGCCATACTAACGC
GCGACTTTGTTGGCCTG
GTAAGCGAAACTTCCCTTCTTTAAAGCCTTTTGGAGGTCTTCCATTCATGCCCAAAGCTCCAAAACGAAAGGGGACTCAAAAACAAAATGCGTTTTTTTTTAT
GTTGGTCAGACTGGAGGACCAACATGGCAAGTGAAGAAAGGAAGACGCGACGGGAGAATCTCCAGAGCGGAAGCCGCCACCGCCAATCTCCCCGGCGCGGAATTCTCCGTAAACCAACTT
CTCAAAAACTTTGCGACCAAGGGTCTCAATCTCGTCGACCTGGTGTCACTCTCAG
GTATGCACAGAAGTCACAAAAACATCAATCACTCACTTTTCTTCTTCCATGATCCAAACTACACA
AACAAAAAACTCCAGGAGCTCACACATTTGGCTTTGCACACTGCGATCAATTCAGCAGCCGGCTCTACAACTTCAGCAGCAGTAACAGGATGGATCCAACAATGAGCTCCAGCTTCGCGT
CGGACCTCAAGAAATCGTGCCCCATCCGGGGCGGAAATCCAAACCTGGTGGAACCGTTTGATCCAGTGACCCCTTTCGAGTTTGACAACGCGTACTACAAGAATCTGTTGGCGGGCAGAG
GGTTGGTAACCTCGGACCAGGAACTTTACTCGGACAGGCGGACCAGGAAGCTTGTCCGCTTGTTTTCAAAGAAGCGCCAGCGCTTCTTTAATGCGTTTGCTGACGCCATGGACAAAATGG
GCAGCATCGGCGTCAAGACAGGGACGAGCGGGGAAATCAGAAGGGATTGTAGCAGGATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCGCTACGATTTCATGGATAAAACATTGCTACTTTTGCTAGTGATTACAGTTTGCGTTTTCTCTTCCTCGGCCCAACTCTCGGTTGGCTTCTACGGCAGGACCTGCCCGCGAGTG
GAATCCATCGTCAAGCGAGTAGCTCTCGACAAATTTAAGCAAGCACCAACATCTGCCGCTGCCACAGTCCGTCTCTTCTTCCACGACTGCTTC
GGGTGTGATGCTTCCGTGACCTTAGCA
TCCACGCCGGCAAACAGAGCCGAGAAGGACGCGGACATCAACAAATCCCTGGCCGGAGACGCGTTTGATTCGGTGATGAAAGCCAAGAAAGCCGTGGAAGCCGAGTGCCCGGGAGTGGTC
TCTTGCGCCGATGTTCTCGCCATACTAACGCGCGACTTTGTTGGCCTG
ACTGGAGGACCAACATGGCAAGTGAAGAAAGGAAGACGCGACGGGAGAATCTCCAGAGCGGAAGCCGCCACC
GCCAATCTCCCCGGCGCGGAATTCTCCGTAAACCAACTTCTCAAAAACTTTGCGACCAAGGGTCTCAATCTCGTCGACCTGGTGTCACTCTCAG
GAGCTCACACATTTGGCTTTGCACAC
TGCGATCAATTCAGCAGCCGGCTCTACAACTTCAGCAGCAGTAACAGGATGGATCCAACAATGAGCTCCAGCTTCGCGTCGGACCTCAAGAAATCGTGCCCCATCCGGGGCGGAAATCCA
AACCTGGTGGAACCGTTTGATCCAGTGACCCCTTTCGAGTTTGACAACGCGTACTACAAGAATCTGTTGGCGGGCAGAGGGTTGGTAACCTCGGACCAGGAACTTTACTCGGACAGGCGG
ACCAGGAAGCTTGTCCGCTTGTTTTCAAAGAAGCGCCAGCGCTTCTTTAATGCGTTTGCTGACGCCATGGACAAAATGGGCAGCATCGGCGTCAAGACAGGGACGAGCGGGGAAATCAGA
AGGGATTGTAGCAGGATCAACTGA

Retrieve as FASTA