Entry information : SmPrx80-2_66 (SmPrx80b_66)
Entry ID 7082
Creation 2009-10-21 (Paula Nunes)
Last sequence changes 2009-10-21 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx80-2_66 (SmPrx80b_66)
Name (synonym) SmPrx80-2_66 (SmPrx80b_66)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx80-2_66
start..stop
S start..stop
SmPrx80-1_13 650 0 1..321 7..327
GbPrx49 389 3e-136 4..321 24..344
GbPrx29 385 4e-135 3..321 5..328
ApuncPrx29 385 7e-135 21..321 32..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 484636..484830 195 N° 2 484353..484547 195 N° 3 484076..484241 166 N° 4 483586..483995 410
complement(join(483586..483995,484076..484241,484353..484547,484636..484830))


exon

Literature and cross-references SmPrx80-2_66 (SmPrx80b_66)
DNA ref. Phytozome 12:   scaffold_66 (484830..483586)
mRNA ref. JGI transcript:   122015
Protein sequence: SmPrx80-2_66 (SmPrx80b_66)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (301)
PWM (Da):   %s   34740.69 (32666.6) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.64 (9.79) Peptide Signal:   %s   cut: 21 range:21-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDKTLLLLLVITVCVSSSSAQLSVGFYGRSCPRVESIVKRVALDKFKQAPTSAAATVRLFFHDCFGCDASVTLASTPANRAEKDADINKSLAGDAFDSVMKAKKAVEAECPGVVSCADVLAILTRDFVGLTGGPAWQVKKGRRDGRISRAEAATANLPGAEFSVNQLLKNFATKGLNLVDLVSLSGAHTFGFAHCDQFSSRLYNFSSSNRMDPTMSSSFASDLKKSCPIRGGNPNLVEPFDPVTPFEFDNAYYKNLLAGRGLVTSDQELYSDRRTRKLVRLFSKKRQRFFNAFADAMDKMGSIGVKTGTSGEIRRDCSRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAAAACATTGCTACTTTTGCTAGTGATTACAGTTTGCGTTTCCTCTTCCTCGGCCCAACTCTCGGTTGGCTTCTACGGCAGGAGCTGCCCGCGAGTGGAATCCATCGTCAAGCGA
GTAGCTCTCGACAAATTTAAGCAAGCACCAACATCTGCCGCTGCCACAGTCCGTCTCTTCTTCCACGACTGCTTC
GTCGAGGCAAGTGGAGAGAAAAAAATCTAGTTTTTTTTCTCTCAT
CCCTGATAAACTTGTCCGGATTTCCATGAATTCCTCCATCCAGGGGTGTGATGCTTCCGTGACCTTAGCATCCACGCCGGCAAACAGAGCCGAGAAGGACGCGGACATCAACAAATCCCT
GGCCGGAGACGCATTTGATTCGGTGATGAAAGCCAAGAAAGCCGTGGAAGCCGAGTGCCCGGGAGTGGTCTCTTGCGCCGATGTTCTCGCCATACTAACGCGCGACTTTGTTGGCCTG
GT
AAGCGAAACTTCCCTTCTTTAAAGCCTTTTGGAGGTCTTCCATTCATGCCCAAAGCTCCAAAACGAAAGGGGACTCAAAAACAAAATGCGTTTTTTTTATGTTGGTCAGACTGGAGGACC
AGCATGGCAAGTGAAGAAAGGAAGACGCGACGGGAGAATCTCCAGAGCGGAAGCCGCCACTGCCAATCTCCCCGGCGCGGAATTCTCCGTAAACCAACTTCTCAAAAACTTTGCGACCAA
GGGTCTCAATCTCGTCGACCTGGTGTCACTCTCAG
GTATGCGCAGAAGTCACCAAAACATCAATCACTCACTTTTCTTCTTCCATGATCCAAACTACACAAACAAAAAACTCCAGGAGCT
CACACATTTGGCTTTGCACACTGCGATCAATTCAGCAGCCGGCTCTACAACTTCAGCAGCAGTAACAGGATGGATCCAACAATGAGCTCCAGCTTCGCGTCGGACCTCAAGAAATCGTGC
CCCATCCGGGGCGGAAATCCAAACCTGGTGGAGCCGTTTGATCCAGTGACCCCTTTCGAGTTTGACAACGCGTACTACAAGAATCTGTTGGCGGGCAGAGGGTTGGTAACCTCGGACCAG
GAACTTTACTCGGACAGGCGGACCAGGAAGCTTGTCCGCTTGTTTTCAAAGAAGCGCCAGCGCTTCTTTAATGCGTTTGCTGACGCCATGGACAAAATGGGCAGCATCGGCGTCAAAACA
GGGACGAGCGGGGAAATCAGAAGGGATTGTAGCAGGATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAAAACATTGCTACTTTTGCTAGTGATTACAGTTTGCGTTTCCTCTTCCTCGGCCCAACTCTCGGTTGGCTTCTACGGCAGGAGCTGCCCGCGAGTGGAATCCATCGTCAAGCGA
GTAGCTCTCGACAAATTTAAGCAAGCACCAACATCTGCCGCTGCCACAGTCCGTCTCTTCTTCCACGACTGCTTC
GGGTGTGATGCTTCCGTGACCTTAGCATCCACGCCGGCAAACAGA
GCCGAGAAGGACGCGGACATCAACAAATCCCTGGCCGGAGACGCATTTGATTCGGTGATGAAAGCCAAGAAAGCCGTGGAAGCCGAGTGCCCGGGAGTGGTCTCTTGCGCCGATGTTCTC
GCCATACTAACGCGCGACTTTGTTGGCCTG
ACTGGAGGACCAGCATGGCAAGTGAAGAAAGGAAGACGCGACGGGAGAATCTCCAGAGCGGAAGCCGCCACTGCCAATCTCCCCGGCGCG
GAATTCTCCGTAAACCAACTTCTCAAAAACTTTGCGACCAAGGGTCTCAATCTCGTCGACCTGGTGTCACTCTCAG
GAGCTCACACATTTGGCTTTGCACACTGCGATCAATTCAGCAGC
CGGCTCTACAACTTCAGCAGCAGTAACAGGATGGATCCAACAATGAGCTCCAGCTTCGCGTCGGACCTCAAGAAATCGTGCCCCATCCGGGGCGGAAATCCAAACCTGGTGGAGCCGTTT
GATCCAGTGACCCCTTTCGAGTTTGACAACGCGTACTACAAGAATCTGTTGGCGGGCAGAGGGTTGGTAACCTCGGACCAGGAACTTTACTCGGACAGGCGGACCAGGAAGCTTGTCCGC
TTGTTTTCAAAGAAGCGCCAGCGCTTCTTTAATGCGTTTGCTGACGCCATGGACAAAATGGGCAGCATCGGCGTCAAAACAGGGACGAGCGGGGAAATCAGAAGGGATTGTAGCAGGATC
AACTGA

Retrieve as FASTA