Entry information : SmPrx59-2_61 (SmPrx59b_61)
Entry ID 7088
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2009-10-22 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx59-2_61 (SmPrx59b_61)
Name (synonym) SmPrx59-2_61 (SmPrx59b_61)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx59-2_61
start..stop
S start..stop
SmPrx59-1_19 648 0 1..333 1..332
ScucPrx13 389 1e-136 29..332 26..326
CmichPrx14 389 2e-136 32..332 42..343
PabPrx86 387 2e-135 32..333 25..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 505923..506153 231 N° 2 506210..506404 195 N° 3 506458..506623 166 N° 4 506707..507116 410
join(505923..506153,506210..506404,506458..506623,506707..507116)


exon

Literature and cross-references SmPrx59-2_61 (SmPrx59b_61)
DNA ref. Phytozome 12:   scaffold_61 (505923..507116)
mRNA ref. JGI transcript:   119731
Protein sequence: SmPrx59-2_61 (SmPrx59b_61)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333
PWM (Da):   %s   36536.35  
PI (pH):   %s   9.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLVLHEAAQSATGVQLQNQTQNQQRQQQQFLSVDYYKRSCPDVEKIVHQVMVQKFREAPVAAAGTLRIFFHDCMVQGCDASVLAASTSRNKAEKDFDINLSLPGDGFDAVMRAKQAVENRCPRTVSCADILAIASRDLIGMIGGPFWPVKKGRKDSYTSYAARVPGNLPSSKNTVSELMHLFSSKGFTTEEMVALAGAHTAGFAHCKEFNDRIYNWKNTSRIDPTMNPLYAANLRLACPRNVDPTIVANLDVTTSKKFDNVYYQNLQKGLGLLSTDQALFNDPQTKPLVNRFAASQEQFFAAFASAMQKLGSIGVKSASQGNIRINCAAFNQ

Retrieve as FASTA  
Remarks Complete seuqnece from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGGTTTTGCACGAAGCAGCACAGAGTGCCACTGGGGTTCAGCTGCAAAATCAAACGCAAAACCAGCAGCGGCAGCAGCAGCAATTCCTGAGTGTGGACTACTACAAGCGCTCC
TGTCCAGACGTGGAGAAGATTGTCCACCAAGTCATGGTCCAGAAGTTCAGGGAGGCGCCCGTGGCAGCCGCTGGGACATTGCGCATCTTCTTTCATGACTGCATGGTCCAG
GTAAGAAGA
ATTCAGCTCACAAGCTCAATGTACATACCTTTCCTTCCCCCCTCCAGGGTTGTGATGCTTCCGTCCTCGCCGCCTCCACCTCCCGCAACAAAGCCGAGAAGGATTTCGACATCAACCTCT
CACTTCCGGGCGATGGTTTCGACGCCGTTATGCGAGCCAAGCAGGCTGTCGAGAACAGATGCCCGAGGACAGTCTCGTGTGCCGACATTCTCGCAATTGCGTCGAGAGACCTGATTGGAA
TG
GTACGTTGTCGTCCTCCACAGGGGCAGAAGGAAGCTGAGGCTTGGTTTTGCAGATTGGAGGCCCCTTCTGGCCGGTGAAGAAAGGCCGCAAAGACAGCTACACGTCGTATGCTGCCAG
AGTCCCCGGCAACCTGCCTTCGTCCAAGAACACAGTTTCGGAGCTCATGCATCTCTTCTCGTCCAAAGGATTCACCACCGAAGAAATGGTTGCACTGGCCG
GTAAGTAGCACTCTGAATA
GGATTCTTTGCCTGGATCGATCAATTGGGAAGCTTGCTTGCCGAATGTCTCGGGGTGGGTGCAGGAGCACATACCGCCGGCTTTGCGCATTGCAAAGAGTTCAACGACCGCATCTACAAC
TGGAAGAATACGTCCCGCATTGATCCCACCATGAATCCGCTGTATGCCGCCAACTTGAGGCTGGCCTGTCCCCGCAACGTGGATCCAACCATCGTCGCCAACTTGGACGTAACAACATCC
AAGAAGTTCGACAACGTCTACTACCAAAACTTGCAAAAGGGACTGGGTTTGTTGAGCACCGACCAGGCCCTGTTTAACGACCCCCAGACGAAGCCTCTGGTGAACAGGTTTGCGGCGTCG
CAGGAGCAATTCTTCGCGGCGTTCGCCTCCGCGATGCAAAAGCTGGGCAGCATCGGCGTCAAGTCGGCTTCACAAGGCAACATCCGGATAAACTGCGCAGCCTTCAACCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGGTTTTGCACGAAGCAGCACAGAGTGCCACTGGGGTTCAGCTGCAAAATCAAACGCAAAACCAGCAGCGGCAGCAGCAGCAATTCCTGAGTGTGGACTACTACAAGCGCTCC
TGTCCAGACGTGGAGAAGATTGTCCACCAAGTCATGGTCCAGAAGTTCAGGGAGGCGCCCGTGGCAGCCGCTGGGACATTGCGCATCTTCTTTCATGACTGCATGGTCCAG
GGTTGTGAT
GCTTCCGTCCTCGCCGCCTCCACCTCCCGCAACAAAGCCGAGAAGGATTTCGACATCAACCTCTCACTTCCGGGCGATGGTTTCGACGCCGTTATGCGAGCCAAGCAGGCTGTCGAGAAC
AGATGCCCGAGGACAGTCTCGTGTGCCGACATTCTCGCAATTGCGTCGAGAGACCTGATTGGAATG
ATTGGAGGCCCCTTCTGGCCGGTGAAGAAAGGCCGCAAAGACAGCTACACGTCG
TATGCTGCCAGAGTCCCCGGCAACCTGCCTTCGTCCAAGAACACAGTTTCGGAGCTCATGCATCTCTTCTCGTCCAAAGGATTCACCACCGAAGAAATGGTTGCACTGGCCG
GAGCACAT
ACCGCCGGCTTTGCGCATTGCAAAGAGTTCAACGACCGCATCTACAACTGGAAGAATACGTCCCGCATTGATCCCACCATGAATCCGCTGTATGCCGCCAACTTGAGGCTGGCCTGTCCC
CGCAACGTGGATCCAACCATCGTCGCCAACTTGGACGTAACAACATCCAAGAAGTTCGACAACGTCTACTACCAAAACTTGCAAAAGGGACTGGGTTTGTTGAGCACCGACCAGGCCCTG
TTTAACGACCCCCAGACGAAGCCTCTGGTGAACAGGTTTGCGGCGTCGCAGGAGCAATTCTTCGCGGCGTTCGCCTCCGCGATGCAAAAGCTGGGCAGCATCGGCGTCAAGTCGGCTTCA
CAAGGCAACATCCGGATAAACTGCGCAGCCTTCAACCAGTAA

Retrieve as FASTA