Entry information : SmPrx40-1_51 (SmPrx40a_51)
Entry ID 7137
Creation 2009-11-20 (Paula Nunes)
Last sequence changes 2009-11-20 (Paula Nunes)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: SmPrx40-1_51 (SmPrx40a_51)
Name (synonym) SmPrx40-1_51 (SmPrx40a_51)
Class Class III peroxidase    [Orthogroup: Prx177]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx40-1_51
start..stop
S start..stop
SmPrx40-2_71 627 0 1..316 1..316
SmPrx39-1_51 390 2e-137 1..316 1..324
SmPrx39-2_71 389 1e-136 1..316 1..324
MePrx122 279 3e-93 8..316 28..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 935418..935627 210 N° 2 935157..935348 192 N° 3 934940..935102 163 N° 4 934499..934884 386
complement(join(934499..934884,934940..935102,935157..935348,935418..935627))


exon

Literature and cross-references SmPrx40-1_51 (SmPrx40a_51)
DNA ref. Phytozome 11:   scaffold_51 (935627..934499)
mRNA ref. JGI transcript:   115533 [Incorrect prediction]
Protein sequence: SmPrx40-1_51 (SmPrx40a_51)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (299)
PWM (Da):   %s   33286.02 (31571.0)  
PI (pH):   %s   6.5 (6.12) Peptide Signal:   %s   cut: 18 range:18-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAKFLLVLVVVATVSSNCRVKGALDRGFYDDSCPPFEVIVSGTVQSFLDRDPSVAPGLLRMLFHDAFVGGLDGSPLLNSSGGSDPPERLATPNLSLHGFDLIDAIKSKLEGICPGIVSCADILATAARDAITLTNGPFWRVKFGRRDGRSSNFNEANNLPSPFEDANGLLAKFAAKGFNPEEMVLLQGGGHSIGVGHCPLIASRLSNPDPTLDPSYAAQLRPICSANANAALPNDPVTPPLLDNQYFANVQARKGLFTSDQELLFDGRTKPAIDKYAASSSAFSRDFAKAIQKLSELGVLTGSQGSVRKICAIAN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from JGI: fusion of exons 1 and 2 of the SmPr40a and exons 3 and 4 of SmPrx39a. No ESTs. Missing 'c'. containing motif fhda.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAAAGTTCTTGCTTGTGTTGGTAGTAGTGGCGACTGTTTCGAGCAATTGTAGAGTAAAAGGAGCACTGGACCGAGGATTCTACGATGATTCGTGCCCTCCTTTCGAAGTGATC
GTCTCTGGAACCGTCCAAAGTTTCCTCGATAGAGATCCTAGTGTTGCTCCGGGTCTTCTCCGGATGCTCTTTCACGACGCTTTTGTTGGA
GTGAGTGTCAAGAGCTAAACTTCAAAGCCT
TCCCTGGAGATCTAACGAAAGAACGATTGTTTCTTCCAGGGCCTTGATGGGTCACCCTTGCTCAATTCATCGGGAGGGAGTGATCCACCGGAGAGACTTGCGACTCCAAATCTCTCGCTG
CATGGCTTTGATTTGATCGACGCGATCAAGTCCAAGCTCGAGGGGATTTGCCCCGGCATTGTTTCCTGCGCGGATATCTTGGCAACCGCGGCCAGGGACGCCATAACTTTG
GTTAGTTTC
TTCCAAATTTCTAACATCCGGTAAAACTTTCGCTTCTTTGTCTAGACGAATGGACCGTTTTGGAGGGTGAAATTCGGTCGGCGAGATGGAAGAAGCTCAAACTTCAACGAAGCAAACAAT
CTCCCCAGCCCATTCGAAGACGCAAATGGATTGCTTGCGAAATTTGCTGCGAAAGGCTTCAATCCCGAGGAGATGGTGCTCCTCCAAG
GTAGAATACGATGGTTTTCGATCTAGAGATGA
TCTAATCCATGGATATGAACCAGGAGGAGGACACAGCATTGGTGTGGGGCACTGCCCACTCATCGCGTCTCGCCTCTCCAACCCAGACCCCACATTGGATCCCTCCTACGCCGCGCAGCT
CCGACCGATTTGCAGCGCCAACGCCAATGCCGCACTGCCAAACGATCCAGTCACGCCACCGCTGCTCGACAACCAGTACTTTGCAAACGTCCAGGCCAGGAAGGGGCTCTTCACCTCGGA
TCAAGAGCTCCTTTTCGATGGGCGCACGAAGCCAGCGATCGACAAGTACGCAGCCTCCAGCAGCGCGTTTTCGAGGGATTTCGCGAAGGCGATTCAGAAGCTCTCGGAGCTTGGCGTGCT
CACGGGCTCGCAGGGAAGCGTCCGGAAGATCTGTGCCATTGCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAAAGTTCTTGCTTGTGTTGGTAGTAGTGGCGACTGTTTCGAGCAATTGTAGAGTAAAAGGAGCACTGGACCGAGGATTCTACGATGATTCGTGCCCTCCTTTCGAAGTGATC
GTCTCTGGAACCGTCCAAAGTTTCCTCGATAGAGATCCTAGTGTTGCTCCGGGTCTTCTCCGGATGCTCTTTCACGACGCTTTTGTTGGA
GGCCTTGATGGGTCACCCTTGCTCAATTCA
TCGGGAGGGAGTGATCCACCGGAGAGACTTGCGACTCCAAATCTCTCGCTGCATGGCTTTGATTTGATCGACGCGATCAAGTCCAAGCTCGAGGGGATTTGCCCCGGCATTGTTTCCTGC
GCGGATATCTTGGCAACCGCGGCCAGGGACGCCATAACTTTG
ACGAATGGACCGTTTTGGAGGGTGAAATTCGGTCGGCGAGATGGAAGAAGCTCAAACTTCAACGAAGCAAACAATCTC
CCCAGCCCATTCGAAGACGCAAATGGATTGCTTGCGAAATTTGCTGCGAAAGGCTTCAATCCCGAGGAGATGGTGCTCCTCCAAG
GAGGAGGACACAGCATTGGTGTGGGGCACTGCCCA
CTCATCGCGTCTCGCCTCTCCAACCCAGACCCCACATTGGATCCCTCCTACGCCGCGCAGCTCCGACCGATTTGCAGCGCCAACGCCAATGCCGCACTGCCAAACGATCCAGTCACGCCA
CCGCTGCTCGACAACCAGTACTTTGCAAACGTCCAGGCCAGGAAGGGGCTCTTCACCTCGGATCAAGAGCTCCTTTTCGATGGGCGCACGAAGCCAGCGATCGACAAGTACGCAGCCTCC
AGCAGCGCGTTTTCGAGGGATTTCGCGAAGGCGATTCAGAAGCTCTCGGAGCTTGGCGTGCTCACGGGCTCGCAGGGAAGCGTCCGGAAGATCTGTGCCATTGCCAACTAA

Retrieve as FASTA