Entry information : ZmPrx18
Entry ID 714
Creation 2006-02-02 (Christophe Dunand)
Last sequence changes 2006-02-02
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx18
Name ZmPrx18
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Apex
Ears
Embryosac
Pericycle cells (roots)
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx18
start..stop
S start..stop
SbPrx54 670 0 1..333 1..334
SiPrx17 658 0 1..333 1..334
SofPrx04 642 0 1..333 1..334
OsPrx03 618 0 5..331 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40530081..40530305 225 N° 2 40529257..40529448 192 N° 3 40528959..40529124 166 N° 4 40528439..40528857 419
complement(join(40528439..40528857,40528959..40529124,40529257..40529448,4053008 1..40530305))


exon

Literature and cross-references ZmPrx18
Literature REFERENCE 1 Bohnert,H., et al., NSF Grant DBI-0211842: Functional Genomics of Root Growth and Root Signaling Under Drought.
REFERENCE 2 Dembinsky,D., Woll,K., Saleem,M., Liu,Y., Fu,Y., Borsuk,L.A., Lamkemeyer,T., Fladerer,C., Madlung,J., Barbazuk,B., Nordheim,A., Nettleton,D., Schnable,P.S. and Hochholdinger,F. Transcriptomic and proteomic analyses of pericycle cells of the maize primary root. Plant Physiol. 145 (3), 575-588 (2007).
REFERENCE 3 Alexandrov N.N., Brover V.V., Freidin S., Troukhan M.E., Tatarinova T.V., Zhang H., Swaller T.J., Lu Y.-P., Bouck J., Flavell R.B., Feldmann K.A.Insights into corn genes derived from large-scale cDNA sequencing. Plant Mol. Biol. 69:179-194(2009)
Protein ref. GenPept:   NP_001148509 UniProtKB:   B6T3V1
DNA ref. GenBank:   AC211395.4 (125101..126964)
mRNA ref. GenBank:   EU959666
EST ref. UniGene:   Zm.4338
Protein sequence: ZmPrx18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (309)
PWM (Da):   %s   35527.97 (33168.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.41 (8.56) Peptide Signal:   %s   cut: 25 range:25-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSMGCLVLLCLVSSLLPSAVLGHPWGGLFPQFYDHSCPKAKEIVQSIVAQAVAKETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNRNSLRGFEVIDQIKAALEAACPGTVSCADIVALAARDSTALVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKRQGLNVVDVVALSGGHTIGMSRCTSFRQRLYNQTGNGMADSTLDVSYAAKLRQGCPRSGGDNNLFPLDFITPAKFDNFYYKNLLAGKGLLSSDEILLTKSAETAALVKAYAADVNLFFQHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNDH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and 83 ESTs. Unigene contains ESTs from ZmPrx54. Cultivar="F2", "B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCCATGGGTTGTCTCGTCTTGCTCTGCCTTGTTTCTTCTCTCCTTCCCAGTGCCGTCCTTGGCCACCCATGGGGTGGCTTGTTCCCACAGTTCTATGACCATTCGTGCCCC
AAGGCGAAGGAGATTGTGCAGTCCATTGTGGCACAGGCTGTGGCCAAGGAGACCAGGATGGCGGCATCTTTGGTCAGACTGCATTTCCATGACTGCTTTGTCAAG
GTTCAATTCTGCTTC
CTCTGTTATGTTCTTTATATTACATGCTCTGACAAACTATAAAGCTTGATACTGCAGTACAATATAACAAGTTAGCGACACAAGTTTTGTACTTCAAGTCTTTTAACTATATGTTGGTGC
AATAAGATTATGAGTAATCCATATGAAGGTGTTGCAAGCGAATATGAAAGGCAAAGATAAACGGATGAACCCATTACTAGCTTTGGCTGTATCAGACCAATAACTTGAAATGCACTTGTG
CTAGCATGCCTAAGTATTAGAAAAGGTAGCATGGGAGAATCTATATTATTTTGGCTAACTTCTTTAGTTACTATTGATTGATGAGAAAGCCTACCATTGCCCATGCCAGCCCTAATGTCC
CGGTGACATGATTGAGCCAGTACTATGATTAATTTACTCTATTGTTCTCCTTTTTTGAGTGCTGTATAAGATGTCCTTTTTTTGAGCCACTCGAGAAGATGTTTACTTAACTCTAGTGCG
CAATGATTGGAGCTCTCAGTGCAACGCATGTGCTCTGTAATCTACTGTCACCACTACCCTGTAGTGTGTGCTTAAACTCTAAACTATTCCACGTGGCTAGTAATTACCAATCATTTACAA
CACTGTTACATGTGTAGGGCTGCGATGCTTCGGTGCTGTTGGACAACAGCAGCAGCATAGTTAGTGAGAAAGGGTCCAACCCGAACAGGAACTCCCTCAGGGGGTTTGAGGTGATCGACC
AGATTAAGGCTGCTCTTGAGGCTGCCTGCCCAGGCACAGTCTCCTGTGCCGACATTGTTGCCCTTGCGGCTCGTGATTCCACCGCCCTG
GTATGTTCCACACTTCCACTATCGACAATCC
TTTCCAACCTCAAGGAACAGACATGATATTTGTGAGTGTATATATATATATATAGTGATAGCTTTGGCAAACTTAGATATTTTCTGAGCTCTAAACCGTAGGTTGGTGGACCATACTGGG
ACGTGCCACTTGGCCGGAGAGACTCGCTCGGTGCAAGCATCCAGGGCTCCAACAATGACATCCCAGCCCCCAACAACACACTCCCCACTATCATCACCAAGTTCAAGCGCCAGGGCCTCA
ATGTTGTTGATGTTGTCGCCCTCTCAG
GTGATTTTTCTTGTATTTATTAGTAACATCTGTCCTTCGTTATTCACCAACTTAGCGCACACTCATATTACGCATGGATACAATATCATGTGT
GAATACAGGTGGTCACACCATTGGTATGTCTCGGTGCACTAGTTTCCGGCAGAGGCTATACAACCAGACAGGCAATGGCATGGCTGACAGCACACTGGATGTATCCTACGCCGCAAAGCT
GAGGCAGGGATGCCCCCGCTCTGGTGGTGACAACAACCTCTTCCCCTTGGACTTCATCACCCCTGCCAAGTTTGACAATTTTTACTACAAGAACCTCCTGGCCGGCAAGGGCCTTCTAAG
CTCTGATGAGATTCTGTTAACCAAGAGCGCTGAGACAGCGGCCCTCGTGAAGGCATATGCTGCTGATGTCAATCTCTTCTTCCAGCACTTTGCACAGTCTATGGTGAATATGGGCAACAT
CTCGCCACTGACAGGGTCACAAGGTGAGATCAGGAAGAACTGCAGGAGGCTCAACAATGACCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCCATGGGTTGTCTCGTCTTGCTCTGCCTTGTTTCTTCTCTCCTTCCCAGTGCCGTCCTTGGCCACCCATGGGGTGGCTTGTTCCCACAGTTCTATGACCATTCGTGCCCC
AAGGCGAAGGAGATTGTGCAGTCCATTGTGGCACAGGCTGTGGCCAAGGAGACCAGGATGGCGGCATCTTTGGTCAGACTGCATTTCCATGACTGCTTTGTCAAG
GGCTGCGATGCTTCG
GTGCTGTTGGACAACAGCAGCAGCATAGTTAGTGAGAAAGGGTCCAACCCGAACAGGAACTCCCTCAGGGGGTTTGAGGTGATCGACCAGATTAAGGCTGCTCTTGAGGCTGCCTGCCCA
GGCACAGTCTCCTGTGCCGACATTGTTGCCCTTGCGGCTCGTGATTCCACCGCCCTG
GTTGGTGGACCATACTGGGACGTGCCACTTGGCCGGAGAGACTCGCTCGGTGCAAGCATCCAG
GGCTCCAACAATGACATCCCAGCCCCCAACAACACACTCCCCACTATCATCACCAAGTTCAAGCGCCAGGGCCTCAATGTTGTTGATGTTGTCGCCCTCTCAG
GTGGTCACACCATTGGT
ATGTCTCGGTGCACTAGTTTCCGGCAGAGGCTATACAACCAGACAGGCAATGGCATGGCTGACAGCACACTGGATGTATCCTACGCCGCAAAGCTGAGGCAGGGATGCCCCCGCTCTGGT
GGTGACAACAACCTCTTCCCCTTGGACTTCATCACCCCTGCCAAGTTTGACAATTTTTACTACAAGAACCTCCTGGCCGGCAAGGGCCTTCTAAGCTCTGATGAGATTCTGTTAACCAAG
AGCGCTGAGACAGCGGCCCTCGTGAAGGCATATGCTGCTGATGTCAATCTCTTCTTCCAGCACTTTGCACAGTCTATGGTGAATATGGGCAACATCTCGCCACTGACAGGGTCACAAGGT
GAGATCAGGAAGAACTGCAGGAGGCTCAACAATGACCACTGA

Retrieve as FASTA