Entry information : SmPrx40-2_71 (SmPrx40b_71)
Entry ID 7140
Creation 2009-11-18 (Paula Nunes)
Last sequence changes 2009-11-18 (Paula Nunes)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: SmPrx40-2_71 (SmPrx40b_71)
Name (synonym) SmPrx40-2_71 (SmPrx40b_71)
Class Class III peroxidase    [Orthogroup: Prx177]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx40-2_71
start..stop
S start..stop
SmPrx40-1_51 627 0 1..316 1..316
SmPrx39-1_51 390 2e-137 1..316 1..324
SmPrx39-2_71 389 1e-136 7..316 9..324
MePrx122 281 5e-94 8..316 28..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 146945..147154 210 N° 2 146684..146875 192 N° 3 146467..146629 163 N° 4 146026..146411 386
complement(join(146026..146411,146467..146629,146684..146875,146945..147154))


exon

Literature and cross-references SmPrx40-2_71 (SmPrx40b_71)
DNA ref. Phytozome 11:   scaffold_71 (147154..146026)
mRNA ref. JGI transcript:   123452 [Incorrect prediction]
Protein sequence: SmPrx40-2_71 (SmPrx40b_71)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (299)
PWM (Da):   %s   33269.99 (31555.0)  
PI (pH):   %s   6.35 (6.02) Peptide Signal:   %s   cut: 18 range:18-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAKFLLVLVVVATVSSNCRVQGALDRGFYDDSCPPFEVIVSGTVQSFLDRDPSVAPGLLRMLFHDAFVGGLDGSPLLNSSGGSDPPERLATPNLSLHGFDLIDAIKSKLEGICPGIVSCADILATAARDAITLTNGPFWRVKFGRRDGRSSNFNEANHLPSPFEDANGLLAKFAAKGFTAEEMVLLQGGGHSIGVGHCPLIASRLSNPDPTLDPSYAAQLRPICSANANAALPNDPVTPPLLDNQYFANVQARKGLFTSDQELLFDGRTKPAIDKYAASSSAFARDFSKAIQKLSELGVLTGSQGSVRKICAIAN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from JGI: fusion of exons 1 and 2 of the SmPr41b, exon 3 of SmPrx40b and exon 4 of SmPrx39b. No ESTs. Missing 'c'. containing motif fhda.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAAAGTTCTTGCTTGTGTTGGTAGTAGTGGCGACTGTTTCGAGCAATTGTAGAGTACAAGGAGCACTGGACCGAGGATTCTACGATGATTCGTGCCCTCCTTTCGAAGTGATC
GTCTCTGGAACCGTCCAAAGTTTCCTCGATAGAGATCCTAGTGTTGCTCCAGGTCTTCTCCGGATGCTCTTTCACGACGCTTTTGTTGGA
GTGAGTGTCAAGAGCTAAACTTCAAAGCCT
TCCCTGGAGATCTAACGAAAGAACGATTGTTTCTTCCAGGGCCTTGATGGGTCACCCTTGCTCAATTCATCGGGAGGGAGTGATCCACCAGAGAGACTTGCGACTCCAAATCTCTCGCTG
CATGGCTTTGATTTGATCGACGCGATCAAGTCCAAGCTCGAGGGGATTTGCCCCGGCATTGTTTCCTGCGCGGATATCTTGGCAACCGCGGCCAGGGACGCCATAACTTTG
GTTAGTTTC
TTCCAAATTTCTGACATCAGGTAAAACTTTCGCTTCTTTGTCTAGACGAATGGACCGTTTTGGAGGGTGAAATTCGGTCGGCGAGATGGAAGAAGCTCAAACTTCAACGAAGCAAACCAT
CTCCCCAGCCCATTCGAAGACGCAAATGGACTGCTTGCGAAATTTGCCGCGAAAGGCTTCACTGCCGAGGAAATGGTGCTCCTCCAAG
GTAGAAAATGATGGTTTTTCATCTAGAGATGA
TCTGATCCATGGATATGAATCAGGAGGAGGACACAGCATTGGTGTGGGGCACTGCCCACTCATCGCGTCTCGCCTCTCCAACCCAGACCCCACATTGGATCCCTCCTACGCCGCGCAGCT
CCGACCGATTTGCAGCGCCAACGCCAATGCCGCACTGCCCAACGATCCAGTCACGCCACCGCTGCTCGACAACCAGTACTTTGCAAACGTCCAGGCCAGGAAGGGGCTCTTCACCTCGGA
TCAAGAGCTCCTTTTCGATGGGCGCACGAAGCCAGCGATCGACAAGTACGCAGCCTCCAGCAGCGCGTTTGCGAGGGATTTCTCGAAGGCGATTCAGAAGCTCTCGGAGCTTGGCGTGCT
CACGGGCTCGCAGGGAAGCGTCCGGAAGATCTGCGCCATTGCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAAAGTTCTTGCTTGTGTTGGTAGTAGTGGCGACTGTTTCGAGCAATTGTAGAGTACAAGGAGCACTGGACCGAGGATTCTACGATGATTCGTGCCCTCCTTTCGAAGTGATC
GTCTCTGGAACCGTCCAAAGTTTCCTCGATAGAGATCCTAGTGTTGCTCCAGGTCTTCTCCGGATGCTCTTTCACGACGCTTTTGTTGGA
GGCCTTGATGGGTCACCCTTGCTCAATTCA
TCGGGAGGGAGTGATCCACCAGAGAGACTTGCGACTCCAAATCTCTCGCTGCATGGCTTTGATTTGATCGACGCGATCAAGTCCAAGCTCGAGGGGATTTGCCCCGGCATTGTTTCCTGC
GCGGATATCTTGGCAACCGCGGCCAGGGACGCCATAACTTTG
ACGAATGGACCGTTTTGGAGGGTGAAATTCGGTCGGCGAGATGGAAGAAGCTCAAACTTCAACGAAGCAAACCATCTC
CCCAGCCCATTCGAAGACGCAAATGGACTGCTTGCGAAATTTGCCGCGAAAGGCTTCACTGCCGAGGAAATGGTGCTCCTCCAAG
GAGGAGGACACAGCATTGGTGTGGGGCACTGCCCA
CTCATCGCGTCTCGCCTCTCCAACCCAGACCCCACATTGGATCCCTCCTACGCCGCGCAGCTCCGACCGATTTGCAGCGCCAACGCCAATGCCGCACTGCCCAACGATCCAGTCACGCCA
CCGCTGCTCGACAACCAGTACTTTGCAAACGTCCAGGCCAGGAAGGGGCTCTTCACCTCGGATCAAGAGCTCCTTTTCGATGGGCGCACGAAGCCAGCGATCGACAAGTACGCAGCCTCC
AGCAGCGCGTTTGCGAGGGATTTCTCGAAGGCGATTCAGAAGCTCTCGGAGCTTGGCGTGCTCACGGGCTCGCAGGGAAGCGTCCGGAAGATCTGCGCCATTGCCAACTAA

Retrieve as FASTA