Entry information : BfuAPx-CcP02
Entry ID 7146
Creation 2010-01-10 (Marcel Zamocky)
Last sequence changes 2010-01-10 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-26 (Christophe Dunand)
Peroxidase information: BfuAPx-CcP02
Name BfuAPx-CcP02
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Botryotinia
Organism Botryotinia fuckeliana (Botrytis cinerea Sclerotinia fuckeliana)    [TaxId: 40559 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BfuAPx-CcP02
start..stop
S start..stop
SsclAPx-CcP01 836 0 1..532 1..532
ApruAPx-CcP03 555 0 1..536 1..537
HC14APx-CcP02 502 1e-174 1..533 1..542
BdotAPx-CcP02 502 2e-174 1..533 1..530
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 180301..180442 142 N° 2 178762..180233 1472  
complement(join(178762..180233,180301..180442))


exon

Literature and cross-references BfuAPx-CcP02
Literature Annotation of the Botryotinia fuckeliana B05.10 genome.
Birren B.W., et al., (Unpublished)
Protein ref. UniProtKB:   A6RXD1
DNA ref. JGI genome:   Supercontig_1.23 (180442..178762)
EST ref. GenBank:   FQ924977.1 [Fragment]
Protein sequence: BfuAPx-CcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   537 (518)
PWM (Da):   %s   57779.21 (55899.1)  
PI (pH):   %s   4.25 (4.22) Peptide Signal:   %s   cut: 20 range:20-537
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGSSLISLGLLPVLSVNAAYTWPSEYDQLEDILYLQQGFIRFGLRDGVTPCSFSSDGGGRQAAAEWIRTAYHDMATHDVDTGLGGLDGSIAFELGRAENPGDAFNSTFAFTENLRSIRASSSDLLAMSVVVATMACGGPIIPFRGGRIDAMKAGVSGVPEPDQDLATHTAIFAKQGFNTAEMITMVACGHTLGGVHGVDFPQITGNGDAENFPKFDSTYTAFDNTVVTEYLGNNSTDPLVISKNDTFNSDKRIFGADNNKTMTSLADPTNFQKQCSDIFARMIDTVPADVTLSEVITPIEVKPSQIALTLAGNNTLSFGGYIRLRTTNRNADDVTVSLQYRDRNNNTSNTTIPVSRENYLLGQSYGFGSEVFTWYGFNTVLDAKTGISSFDVILHTVGAADEIITNNGGGFPLTDAILYQPAQSCQPQISVNDAGQWNITVTAAVRADRINEPVAFDWVSQRTIPGAMVKALEVQRTAMEKVSEEIDGYYLFSGTRSLDNVQWSTTFDVVLGEGDDVSKVEFQSTSAMATSCEAFS

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron) and ESTs. Strain="B05.10".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGGTCATCTTTAATCAGTTTGGGCTTGCTACCCGTGCTGTCAGTTAATGCGGCTTATACTTGGCCCTCAGAGTATGATCAACTAGAAGACATTCTATATCTTCAGCAAGGTTTC
ATACGTTTTGGCCTCAGAGATG
GTAAGTTATCGGAGAGGATGTTTCAAACCGGTATTGAGAATAACTTGTTCACTAATTATCGTATCAGGTGTTACGCCGTGCTCTTTCTCATCGGATGG
AGGTGGTCGTCAGGCGGCTGCGGAATGGATAAGAACTGCTTATCATGATATGGCTACCCATGATGTCGATACTGGTCTTGGAGGACTTGATGGTTCTATAGCCTTTGAGCTTGGGCGAGC
GGAGAACCCTGGTGATGCTTTCAATTCTACCTTTGCATTTACAGAAAACCTCCGCTCAATCAGAGCTTCGTCTTCCGATCTTCTTGCAATGTCCGTTGTCGTTGCCACAATGGCTTGCGG
CGGTCCAATAATTCCATTTAGAGGTGGACGAATCGATGCCATGAAAGCTGGTGTTTCTGGCGTGCCCGAGCCTGATCAAGATTTGGCGACACACACTGCAATCTTCGCAAAGCAAGGATT
CAACACTGCTGAGATGATAACCATGGTAGCATGCGGCCACACTCTCGGAGGTGTTCATGGTGTCGATTTTCCCCAGATTACCGGCAACGGTGACGCAGAAAACTTCCCAAAATTCGACAG
CACCTACACCGCATTCGATAACACTGTTGTAACAGAGTATTTGGGGAACAATTCAACCGACCCGCTTGTGATCAGTAAAAATGATACCTTCAATTCCGATAAACGCATTTTTGGCGCCGA
CAACAACAAAACGATGACTTCTTTAGCAGACCCAACCAATTTCCAGAAACAATGCTCTGACATCTTCGCTCGAATGATCGATACTGTCCCTGCAGACGTCACACTTTCTGAAGTCATCAC
ACCTATCGAAGTAAAGCCATCGCAAATTGCTCTTACCCTAGCTGGAAATAACACTCTATCCTTCGGAGGATACATCCGCCTTCGCACCACCAACCGCAACGCCGATGATGTGACCGTATC
CCTTCAATACCGTGATCGTAATAACAATACTTCGAACACCACAATTCCCGTCAGCAGAGAGAATTACTTGTTGGGTCAAAGCTATGGCTTCGGTTCAGAGGTGTTCACTTGGTATGGATT
CAATACTGTTCTTGATGCTAAAACCGGCATTTCGTCTTTCGATGTCATCTTACATACTGTCGGTGCAGCTGATGAAATCATCACCAATAACGGTGGGGGTTTCCCACTCACAGACGCAAT
TCTCTACCAACCAGCACAATCCTGTCAGCCACAGATATCTGTCAATGACGCAGGCCAGTGGAATATAACAGTCACTGCAGCTGTTCGTGCTGATCGTATCAACGAGCCTGTTGCCTTTGA
CTGGGTGTCTCAGCGTACCATACCAGGCGCGATGGTTAAAGCACTAGAAGTGCAACGTACAGCTATGGAGAAAGTGAGTGAGGAGATCGATGGATATTATCTTTTCAGCGGAACCAGGTC
GCTCGATAACGTACAATGGTCTACTACTTTTGATGTGGTATTGGGAGAGGGAGATGACGTATCGAAAGTAGAGTTCCAGTCGACGTCGGCAATGGCCACGAGCTGCGAGGCATTTTCTTG
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGGTCATCTTTAATCAGTTTGGGCTTGCTACCCGTGCTGTCAGTTAATGCGGCTTATACTTGGCCCTCAGAGTATGATCAACTAGAAGACATTCTATATCTTCAGCAAGGTTTC
ATACGTTTTGGCCTCAGAGATG
GTGTTACGCCGTGCTCTTTCTCATCGGATGGAGGTGGTCGTCAGGCGGCTGCGGAATGGATAAGAACTGCTTATCATGATATGGCTACCCATGATGTC
GATACTGGTCTTGGAGGACTTGATGGTTCTATAGCCTTTGAGCTTGGGCGAGCGGAGAACCCTGGTGATGCTTTCAATTCTACCTTTGCATTTACAGAAAACCTCCGCTCAATCAGAGCT
TCGTCTTCCGATCTTCTTGCAATGTCCGTTGTCGTTGCCACAATGGCTTGCGGCGGTCCAATAATTCCATTTAGAGGTGGACGAATCGATGCCATGAAAGCTGGTGTTTCTGGCGTGCCC
GAGCCTGATCAAGATTTGGCGACACACACTGCAATCTTCGCAAAGCAAGGATTCAACACTGCTGAGATGATAACCATGGTAGCATGCGGCCACACTCTCGGAGGTGTTCATGGTGTCGAT
TTTCCCCAGATTACCGGCAACGGTGACGCAGAAAACTTCCCAAAATTCGACAGCACCTACACCGCATTCGATAACACTGTTGTAACAGAGTATTTGGGGAACAATTCAACCGACCCGCTT
GTGATCAGTAAAAATGATACCTTCAATTCCGATAAACGCATTTTTGGCGCCGACAACAACAAAACGATGACTTCTTTAGCAGACCCAACCAATTTCCAGAAACAATGCTCTGACATCTTC
GCTCGAATGATCGATACTGTCCCTGCAGACGTCACACTTTCTGAAGTCATCACACCTATCGAAGTAAAGCCATCGCAAATTGCTCTTACCCTAGCTGGAAATAACACTCTATCCTTCGGA
GGATACATCCGCCTTCGCACCACCAACCGCAACGCCGATGATGTGACCGTATCCCTTCAATACCGTGATCGTAATAACAATACTTCGAACACCACAATTCCCGTCAGCAGAGAGAATTAC
TTGTTGGGTCAAAGCTATGGCTTCGGTTCAGAGGTGTTCACTTGGTATGGATTCAATACTGTTCTTGATGCTAAAACCGGCATTTCGTCTTTCGATGTCATCTTACATACTGTCGGTGCA
GCTGATGAAATCATCACCAATAACGGTGGGGGTTTCCCACTCACAGACGCAATTCTCTACCAACCAGCACAATCCTGTCAGCCACAGATATCTGTCAATGACGCAGGCCAGTGGAATATA
ACAGTCACTGCAGCTGTTCGTGCTGATCGTATCAACGAGCCTGTTGCCTTTGACTGGGTGTCTCAGCGTACCATACCAGGCGCGATGGTTAAAGCACTAGAAGTGCAACGTACAGCTATG
GAGAAAGTGAGTGAGGAGATCGATGGATATTATCTTTTCAGCGGAACCAGGTCGCTCGATAACGTACAATGGTCTACTACTTTTGATGTGGTATTGGGAGAGGGAGATGACGTATCGAAA
GTAGAGTTCCAGTCGACGTCGGCAATGGCCACGAGCTGCGAGGCATTTTCTTGA

Retrieve as FASTA