Entry information : SbPrx23_BTx623 (Sobic.001G528100.1[2.1] / SB01G049140[1.4])
Entry ID 7149
Creation 2010-01-12 (Christophe Dunand)
Last sequence changes 2011-01-21 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx23_BTx623 (Sobic.001G528100.1[2.1] / SB01G049140[1.4])
Name (synonym) SbPrx23_BTx623 (Sobic.001G528100.1[2.1] / SB01G049140[1.4])
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx23_BTx623
start..stop
S start..stop
SofPrx03 606 0 26..333 23..330
ZmPrx28 554 0 30..333 23..329
SiPrx154 529 0 1..333 1..331
OsPrx33 506 0 25..333 2..311
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 72125635..72125871 237 N° 2 72126305..72126493 189 N° 3 72128238..72128813 576  
join(72125635..72125871,72126305..72126493,72128238..72128813)


exon

Literature and cross-references SbPrx23_BTx623 (Sobic.001G528100.1[2.1] / SB01G049140[1.4])
DNA ref. Phytozome 12:   chromosome_1 (72125635..72128813)
EST ref. GenBank:   CN126734.1 [5' end]
Protein sequence: SbPrx23_BTx623 (Sobic.001G528100.1[2.1] / SB01G049140[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (307)
PWM (Da):   %s   33866.88 (31459.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.73 (4.85) Peptide Signal:   %s   cut: 27 range:27-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGRRSRGGGASGLLVWAVAIAAAAAAAVSRAQLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDGSVLLDSTAGNQAEKDAAPNASLRGFEVIDSAKTRLEQACFGVVSCADILAFAARDALALVGGNAYQVPAGRRDGNVSSAQEAGANLPPPTASVSRLNQVFGAKGLTQADMVALSGAHTVGAARCSSFNGRLYSYGPSGAGQDPSMDPAYLAALTQQCPQVQGSDPAVPMDPVTPTTFDTNYYANLVAKRGLLASDQALLADPTTAAQVVGYTNSPATFQTDFVAAMLKMGNIEVLTGTAGTIRTNCRVAS*

Retrieve as FASTA  
Remarks Complete sequence from 14 ESTs and genomic (chromo 1, introns 1 and 2). cultivar="BTx623". .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGGACGACGCAGTAGAGGAGGAGGCGCGTCGGGCCTGCTAGTGTGGGCGGTGGCGATTGCGGCGGCGGCGGCGGCGGCGGTGTCGCGGGCGCAGCTGCAGGTGGGGTTCTACGAC
ACGCTGTGCCCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGCGGCGTCCGGCAACCCCGGCGTCGCCGCGGGCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAGG
GTC
AGTGCGCGCTCTCTCTTCGATCCATTATTGATGATGAATGACAGCACGGCATGCCGTACAGCTGCTTCGATTCACCTACTATCTGCTACAATTAGCAAGCACGCTGCTGCTGCGCCTTGC
GTACAAGAGGAGGAGAGAAGCTTCGAGTGATCCAATGCAACGTGGTGTCACCCTGCCTCGCTTGCATTGCGTAGTTGCATGTGAAGCTTGCCTGCCTGCCTCTCCTTCCTCTGTTCATTC
ATTCATTCCCCTCCACGCACATATTCGTATTTTTGTCTCCTCGACTTGTTTTACAGCGATAAAGCTATTCATCTGACACATGAGTCACATGCATGCAGTAGAAGCAACAGGAACATCATC
GATCAGTTTTATTTTCTTCTACTGACTGATAGCGAGCTGTGTTGTACTGACGACGACGCATGCATTGCAGGGGTGCGACGGGTCGGTCCTGCTGGACTCGACGGCGGGCAACCAGGCGGA
GAAGGACGCGGCGCCGAACGCGAGCCTGCGCGGGTTCGAGGTGATCGACAGCGCCAAGACGCGGCTGGAGCAGGCCTGCTTCGGCGTCGTCTCCTGCGCCGACATCCTCGCCTTCGCCGC
CCGCGACGCCCTCGCGCTG
GTACGCACTGCTCCCCCTCCCTCCCTCCCTGTGCACCAGTGTCAACTACCTCGCGCTCTCTCACTCTCTCAGTCCACCTACCTTCCAGCTGCTCTGCTCAT
CCACTAGCTTCTCCTCCTATCCGGTGGTTCACTTGAGTCAGCAGTAGTAAATAACAAACACAAAACGACTCCCATCCCAAGATAGAACGCAGAGCTCGATATCGGTCTAGGATCACGCGC
GCGACGCAGTGCAAGTGAAGAGGCATGGCCCGGCCGATTCGTCGGTGCCTCCTTGCCTTTCTGGACGTTTTTTTTTTCTTCCCCCTTCCTTTCTGGATGGGAGATGGATGGTTGCCAGGA
CAGCAGCGTCTTTGGAATGGAAGCGTAAAAAATGGGGACTTTTTTGCTTGTGATTCAGCGATCGCAAGGCCGTCCAGGTCCAGCCTTTCGCGGAAAGCAAGCCCTGGTTGATTGGCGACT
CCACCGAATGATGATGCCCTGTACTGCACGTACGCGCACGTAGGCCGCGGTCGGGCATCGGGTGCGGCCTGCCTGCCTGCCTCCGAAGCAAGCGCACGCACGGTGGCCGTGCAGTGCAGT
GCAGCTAGCAGCCGGCAGGGTGATGCTCCGGCAGAGAGGAGAGGCGTTCGTTTCTTTAGGTGCACGTCTCGGTTTTGTTTGGTTGTTCGGTTCGTTACCGTGCGCATGCACGGGCCTACC
GGTGGGTCGGCGGTGTCCGTAGCAGCAGCAACGGCACATGGTTGTGTCGTGTCGCCCTCCAAAGGCTCAGCGTAGGAGAGGGAGAGAAGCCCAGGACCCCTTTCCCTTAAAACTTTCTTC
TGGAGGTGAAGATGGCATTAAGGAAGTACTTTGTTCAGTTCAGGAATAATAGGAATAGTACTCCATTTGCCTTGGGCTGGGGCCAATTTAGCACTGCAAAAACAAGAAGAATGCTCGTCT
GCCGAATGCCGTTAGGGTCACTGGATTCCATATCGCTATATTTACTGCTCACATGACGGTTGTTTCACACTGTAATGTTTGGCTTGGGACGATATATGGATTGGTCCTATGTGGTCTGTG
CTAACTTGGTCAGCTACATTCTGAACTAGGAGAACCTGGGCACAATTACTAGTGCTGACAACCCGAAAAACACATTGATACGATACCATTAAGTCAACTGATCACGTTCAGCATTAAACA
TGCTGGTCGAGCCTGACTGAGGTGCTGCATCCCCGTTCTAGTATTTGGACAAGCAGCATCTTGTGCACGCGCCGGCAGTATCACCAGCTGGTGAGACGACTGTGAAGTCGGCGTCACACT
GTCACTCATGGTCGTTGCAGCTAGCCAGGGAGCGTAGCGTACGAAACAGAACTTTCCATTACGCAGCTGCAAAACAGAGCACGACGCTGCTAAGAGCCGTCGAGGCAGCATCAAAATCCG
GCGGCGGTTTGACGTCCATGTCTCGACGAGGCGGCCAGCCTTGGGAACGCGGCGTGGGGCACGCCAGGACACGTTCGTGGGCGCATGGTTTTTCGTGGATCCGACGCGCACCCCATGTGC
ACTGCCCCGGGCCCGGCACGTCCACATGGCCTTGTTGCTCTGCCGTCGCAGTCTCCCGCACCCGCCCACCACCCGGAGGGTGGCGACCGGACGTTCCGGGTTCGCAGGCATGTGCCAGCT
CAGCTCGCGTTCGCTGGCTGGCGTGGCGGTTACTGACGAAAGCTCCGGCTAAAAGTGTTCTGTTCTGTCTGATGATAATGCAGGTCGGGGGCAACGCGTACCAGGTGCCGGCTGGTCGGA
GGGACGGCAACGTCTCGTCGGCGCAGGAGGCGGGCGCGAACCTGCCGCCGCCGACGGCGAGCGTGAGCCGGCTGAACCAGGTGTTCGGCGCCAAGGGGCTGACCCAGGCGGACATGGTGG
CGCTGTCGGGCGCGCACACGGTGGGCGCCGCGCGCTGCAGCTCCTTCAACGGCCGGCTCTACTCGTACGGTCCCAGCGGCGCCGGGCAGGACCCGTCCATGGACCCCGCGTACCTGGCGG
CGCTCACGCAGCAGTGCCCGCAGGTGCAGGGGAGCGACCCGGCGGTGCCCATGGACCCCGTCACGCCCACCACCTTCGACACCAACTACTACGCCAACCTGGTCGCCAAGCGCGGCCTGC
TCGCCTCCGACCAGGCGCTGCTCGCCGACCCGACCACCGCCGCGCAGGTGGTCGGATACACCAACAGCCCCGCCACGTTCCAGACCGACTTCGTCGCCGCCATGCTCAAGATGGGCAACA
TCGAGGTGCTCACCGGCACCGCCGGCACCATCCGGACCAACTGCAGGGTGGCTAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGGACGACGCAGTAGAGGAGGAGGCGCGTCGGGCCTGCTAGTGTGGGCGGTGGCGATTGCGGCGGCGGCGGCGGCGGCGGTGTCGCGGGCGCAGCTGCAGGTGGGGTTCTACGAC
ACGCTGTGCCCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGCGGCGTCCGGCAACCCCGGCGTCGCCGCGGGCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAGG
GGG
TGCGACGGGTCGGTCCTGCTGGACTCGACGGCGGGCAACCAGGCGGAGAAGGACGCGGCGCCGAACGCGAGCCTGCGCGGGTTCGAGGTGATCGACAGCGCCAAGACGCGGCTGGAGCAG
GCCTGCTTCGGCGTCGTCTCCTGCGCCGACATCCTCGCCTTCGCCGCCCGCGACGCCCTCGCGCTG
GTCGGGGGCAACGCGTACCAGGTGCCGGCTGGTCGGAGGGACGGCAACGTCTCG
TCGGCGCAGGAGGCGGGCGCGAACCTGCCGCCGCCGACGGCGAGCGTGAGCCGGCTGAACCAGGTGTTCGGCGCCAAGGGGCTGACCCAGGCGGACATGGTGGCGCTGTCGGGCGCGCAC
ACGGTGGGCGCCGCGCGCTGCAGCTCCTTCAACGGCCGGCTCTACTCGTACGGTCCCAGCGGCGCCGGGCAGGACCCGTCCATGGACCCCGCGTACCTGGCGGCGCTCACGCAGCAGTGC
CCGCAGGTGCAGGGGAGCGACCCGGCGGTGCCCATGGACCCCGTCACGCCCACCACCTTCGACACCAACTACTACGCCAACCTGGTCGCCAAGCGCGGCCTGCTCGCCTCCGACCAGGCG
CTGCTCGCCGACCCGACCACCGCCGCGCAGGTGGTCGGATACACCAACAGCCCCGCCACGTTCCAGACCGACTTCGTCGCCGCCATGCTCAAGATGGGCAACATCGAGGTGCTCACCGGC
ACCGCCGGCACCATCCGGACCAACTGCAGGGTGGCTAGCTAG

Retrieve as FASTA