Entry information : AvePrx112-1B ( Prx112-B-Ae / AvePrx112-1B)
Entry ID 7172
Creation 2010-01-27 (Cyril Jourda)
Last sequence changes 2016-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-16 (Achraf Jemmat)
Peroxidase information: AvePrx112-1B ( Prx112-B-Ae / AvePrx112-1B)
Name (synonym) AvePrx112-1B ( Prx112-B-Ae / AvePrx112-1B)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Aegilops
Organism Aegilops ventricosa (Goatgrass) (Triticum ventricosum)    [TaxId: 116981 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AvePrx112-1B
start..stop
S start..stop
TaPrx112-1B 628 0 1..314 1..314
AvePrx112-1A 626 0 1..314 1..314
AvePrx112-1D 596 0 1..314 1..314
TmPrx03 593 0 1..314 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76..285 210 N° 2 402..578 177 N° 3 678..1235 558  
join(76..285,402..578,678..1235)


exon

Literature and cross-references AvePrx112-1B ( Prx112-B-Ae / AvePrx112-1B)
Literature REFERENCE 1. Simonetti E., Lopez-Brana I., Delibes A. Class III Peroxidase characterization and expression pattern in a cereal cyst nematode (Heterodera avenae) resistant hexaploid wheat line.Unpublished
Protein ref. GenPept:   ACF08085 UniProtKB:   C6ETA6
DNA ref. GenBank:   EU595570
Protein sequence: AvePrx112-1B ( Prx112-B-Ae / AvePrx112-1B)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (291)
PWM (Da):   %s   32345.07 (30213.0)  
PI (pH):   %s   8.15 (8.21) Peptide Signal:   %s   cut: 24 range:24-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMGSASCISLVVLVALATAVSGQLSSTFYDTSCPRALATIKSGVAAAVSSDPRMGASLLRLHFHDCFVQGCDASVLLSGMEQNAGPNVGSLRGFGVIDSIKTQLESICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSTTASASLANSDLPGPGSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYGGDTNINTAFATSLKANCPQSGGNSNLANLDTxTPNTFDNAYYTNLLSQKGLLHSDQVLFNNDTTDNTVRNFASNAAAFSSAFTTAMIKMGNIAPLTGTQGQIRLSCSKVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGGTTCTGCCTCTTGCATTTCTCTGGTGGTGCTCGTGGCTCTGGCCACGGCGGTGTCCGGGCAGCTGTCGTCGACGTTCTACGACACGTCGTGCCCCAGGGCTCTGGCCACC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGATCCCCGCATGGGCGCGTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GCAAGTTTCACATAATATATCAGCTCTTTT
TATCTTAACTAACTTTGCTTTAACAGCCGGGATTTAACAAAATCTATACCGTGAAGCGTGAACTAATATGTTTATGTTGGCTACAGGGCTGTGATGCATCTGTTCTGCTGTCTGGCATGG
AACAAAACGCGGGTCCGAACGTGGGGTCGCTGAGGGGCTTCGGCGTCATCGACAGCATCAAGACCCAGCTGGAGAGTATATGCAAGCAGACCGTCTCATGCGCCGACATCCTCACCGTCG
CCGCCCGCGACTCTGTCGTCGCC
GTAAGATCATCTTAGCATATATTCAGTTGCATGATGGATGCTACGTAAAGCTACTAGTCCCGTTTCCCGTACCTAATTTCCTGGTTGGTCTGCATGC
AGCTTGGAGGGCCGTCATGGACTGTTCCACTTGGGAGACGGGACTCCACCACCGCAAGCGCCTCGCTGGCCAACAGCGACCTCCCTGGCCCTGGCTCCAGCCGCTCACAGCTCGAGGCCG
CGTTCCTCAAGAAGAACCTTAACACGGTCGACATGGTCGCGCTCTCAGGGGCGCACACCATCGGGAAGGCCCAGTGCTCCAACTTCCGGACTCGGATCTACGGCGGTGACACCAACATCA
ACACTGCCTTCGCCACGTCTCTCAAGGCCAACTGCCCCCAGTCCGGCGGCAACAGCAACCTGGCGAACCTGGACACGAYGACGCCCAACACGTTCGACAACGCCTACTACACCAACCTCC
TGTCACAAAAAGGTCTCTTGCACTCGGACCAGGTGCTCTTCAACAACGACACCACCGACAACACCGTCCGCAACTTTGCGTCCAACGCGGCGGCCTTCAGCAGCGCCTTCACGACGGCCA
TGATCAAGATGGGAAACATCGCGCCGCTCACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGGTTCTGCCTCTTGCATTTCTCTGGTGGTGCTCGTGGCTCTGGCCACGGCGGTGTCCGGGCAGCTGTCGTCGACGTTCTACGACACGTCGTGCCCCAGGGCTCTGGCCACC
ATCAAGAGCGGCGTGGCGGCCGCCGTGAGCAGCGATCCCCGCATGGGCGCGTCCCTGCTCAGGCTGCACTTCCACGACTGCTTTGTCCAA
GGCTGTGATGCATCTGTTCTGCTGTCTGGC
ATGGAACAAAACGCGGGTCCGAACGTGGGGTCGCTGAGGGGCTTCGGCGTCATCGACAGCATCAAGACCCAGCTGGAGAGTATATGCAAGCAGACCGTCTCATGCGCCGACATCCTCACC
GTCGCCGCCCGCGACTCTGTCGTCGCC
CTTGGAGGGCCGTCATGGACTGTTCCACTTGGGAGACGGGACTCCACCACCGCAAGCGCCTCGCTGGCCAACAGCGACCTCCCTGGCCCTGGC
TCCAGCCGCTCACAGCTCGAGGCCGCGTTCCTCAAGAAGAACCTTAACACGGTCGACATGGTCGCGCTCTCAGGGGCGCACACCATCGGGAAGGCCCAGTGCTCCAACTTCCGGACTCGG
ATCTACGGCGGTGACACCAACATCAACACTGCCTTCGCCACGTCTCTCAAGGCCAACTGCCCCCAGTCCGGCGGCAACAGCAACCTGGCGAACCTGGACACGAYGACGCCCAACACGTTC
GACAACGCCTACTACACCAACCTCCTGTCACAAAAAGGTCTCTTGCACTCGGACCAGGTGCTCTTCAACAACGACACCACCGACAACACCGTCCGCAACTTTGCGTCCAACGCGGCGGCC
TTCAGCAGCGCCTTCACGACGGCCATGATCAAGATGGGAAACATCGCGCCGCTCACCGGGACGCAGGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTGA

Retrieve as FASTA