Entry information : ZmPrx24 (ap1 / Px11)
Entry ID 720
Creation 2006-09-04 (Christophe Dunand)
Last sequence changes 2006-09-04 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx24 (ap1 / Px11)
Name (synonym) ZmPrx24 (ap1 / Px11)
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx24
start..stop
S start..stop
SbPrx97 592 0 12..356 20..361
SiPrx88 582 0 4..357 3..350
ZmPrx58 580 0 22..357 22..351
SofPrx14 572 0 1..357 3..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24815021..24815266 246 N° 2 24814737..24814922 186 N° 3 24813983..24814624 642  
complement(join(24813983..24814624,24814737..24814922,24815021..24815266))


exon

Literature and cross-references ZmPrx24 (ap1 / Px11)
Literature Teichmann T., Guan C., Kristoffersen P., Muster G., Tietz O., Palme K. Cloning and biochemical characterization of an anionic peroxidase from Zea mays. Eur. J. Biochem. 247:826-832(1997)
Protein ref. UniProtKB:   B1A9R4   B4FHG3   O04710
DNA ref. GenBank:   AC194215.3 (75887..77167)
mRNA ref. GenBank:   BT036551
Cluster/Prediction ref. UniGene:   Zm.187
Protein sequence: ZmPrx24 (ap1 / Px11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (332)
PWM (Da):   %s   37817.04 (35420.7)  
PI (pH):   %s   5.9 (5.36) Peptide Signal:   %s   cut: 26 range:26-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARSSGSRPVALVLLALCAAALSSATVTVNEPIANGLSWSFYDVSCPSVEGIVRWHVAEALRRDIGIAAGLIRIFFHDCFPQGCDASVLLSGSNSEQIEVPNQTLRPEALKLIDDIRAAVHAVCGPTVSCADITTLATRDAVVASGGPFFEVPLGRRDGLAPASSDLVGTLPAPFFDVPTLIESFKNRSLDKADLVALSGAHTVGRGHCVSFSDRLPPNADDGTMDPAFRQRLTAKCASDPSGNVVTQVLDVRTPNAFDNKYYFDLIAKQGLFKSDQGLINHPDTKRAATRFALNQAAFFDQFARSMVKMSQMDILTGSAGEIRRNCSVRNTALGDVSSSAHQLETTAGDEGLAADA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1 and 2) and 22 ESTs Contig contains 5 peroxidases ZmPrx 24, 47, 58, 81 and 85.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGTCCAGTGGTAGTAGACCAGTGGCCCTCGTGCTGCTGGCGCTGTGCGCCGCCGCCCTCTCGTCGGCCACGGTGACCGTGAATGAGCCCATCGCCAATGGCCTCTCCTGGAGC
TTCTACGACGTTTCCTGCCCGTCGGTGGAGGGCATCGTGCGCTGGCACGTCGCCGAGGCCCTCCGCCGCGACATCGGCATCGCCGCGGGGCTCATCCGCATCTTCTTCCACGACTGCTTC
CCGCAG
GTAATAACGACCCACCGGCCGGCCCTGCTAGCTATCTAACGTACGTACGACTACGTTGATGCTGACGAACACAGTGCCATGTCGGTTTAATCGATCAGGGCTGCGACGCGTCCG
TCCTCCTGTCTGGTTCCAACAGCGAGCAGATCGAGGTACCCAACCAGACGCTGCGTCCCGAGGCGCTCAAGCTCATCGACGACATCCGCGCCGCCGTCCACGCCGTCTGCGGGCCCACGG
TGTCCTGCGCCGACATCACCACGCTCGCCACCAGGGACGCCGTCGTCGCG
GTAAGTCGATCACCTTGCATCGAGTAGACTGTCTCGTACTTGGGAGTCTACTAGCTAGTGTGTACGTCGT
CGTCCGATCACACCCTATATATATATATATCTGTCCTTCCAGTCCGGCGGCCCCTTCTTCGAGGTTCCTCTCGGGCGGCGCGACGGTCTGGCGCCGGCGTCAAGCGACCTGGTGGGCACC
CTGCCGGCGCCCTTCTTCGACGTGCCGACGCTGATCGAGTCGTTCAAGAACCGGAGCCTGGACAAGGCGGACCTGGTGGCGCTGTCCGGCGCGCACACGGTGGGCCGCGGCCACTGCGTC
TCCTTCAGCGACCGGCTGCCGCCCAACGCGGACGACGGCACCATGGACCCGGCGTTCCGGCAGAGGCTGACGGCTAAGTGCGCCAGCGACCCCAGCGGGAACGTGGTGACCCAGGTGCTG
GACGTGCGCACGCCCAACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGGCTCTTCAAGTCGGACCAGGGCCTCATCAACCACCCGGACACCAAGCGCGCGGCCACC
CGCTTCGCGCTCAACCAGGCCGCCTTCTTCGACCAGTTCGCCAGGTCCATGGTGAAGATGAGCCAGATGGACATCCTCACCGGCAGCGCGGGAGAGATCCGCCGCAACTGCTCCGTGCGC
AACACCGCCCTCGGAGATGTCTCATCGTCAGCCCACCAGCTCGAGACCACCGCCGGCGACGAGGGGCTCGCGGCCGACGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGTCCAGTGGTAGTAGACCAGTGGCCCTCGTGCTGCTGGCGCTGTGCGCCGCCGCCCTCTCGTCGGCCACGGTGACCGTGAATGAGCCCATCGCCAATGGCCTCTCCTGGAGC
TTCTACGACGTTTCCTGCCCGTCGGTGGAGGGCATCGTGCGCTGGCACGTCGCCGAGGCCCTCCGCCGCGACATCGGCATCGCCGCGGGGCTCATCCGCATCTTCTTCCACGACTGCTTC
CCGCAG
GGCTGCGACGCGTCCGTCCTCCTGTCTGGTTCCAACAGCGAGCAGATCGAGGTACCCAACCAGACGCTGCGTCCCGAGGCGCTCAAGCTCATCGACGACATCCGCGCCGCCGTC
CACGCCGTCTGCGGGCCCACGGTGTCCTGCGCCGACATCACCACGCTCGCCACCAGGGACGCCGTCGTCGCG
TCCGGCGGCCCCTTCTTCGAGGTTCCTCTCGGGCGGCGCGACGGTCTG
GCGCCGGCGTCAAGCGACCTGGTGGGCACCCTGCCGGCGCCCTTCTTCGACGTGCCGACGCTGATCGAGTCGTTCAAGAACCGGAGCCTGGACAAGGCGGACCTGGTGGCGCTGTCCGGC
GCGCACACGGTGGGCCGCGGCCACTGCGTCTCCTTCAGCGACCGGCTGCCGCCCAACGCGGACGACGGCACCATGGACCCGGCGTTCCGGCAGAGGCTGACGGCTAAGTGCGCCAGCGAC
CCCAGCGGGAACGTGGTGACCCAGGTGCTGGACGTGCGCACGCCCAACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGGCTCTTCAAGTCGGACCAGGGCCTCATC
AACCACCCGGACACCAAGCGCGCGGCCACCCGCTTCGCGCTCAACCAGGCCGCCTTCTTCGACCAGTTCGCCAGGTCCATGGTGAAGATGAGCCAGATGGACATCCTCACCGGCAGCGCG
GGAGAGATCCGCCGCAACTGCTCCGTGCGCAACACCGCCCTCGGAGATGTCTCATCGTCAGCCCACCAGCTCGAGACCACCGCCGGCGACGAGGGGCTCGCGGCCGACGCGTGA

Retrieve as FASTA