Entry information : SmAPx04-1_7 (SmAPx04a_7)
Entry ID 7200
Creation 2010-02-10 (Christophe Dunand)
Last sequence changes 2010-02-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmAPx04-1_7 (SmAPx04a_7)
Name (synonym) SmAPx04-1_7 (SmAPx04a_7)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx04-1_7
start..stop
S start..stop
SmAPx04-2_36 830 0 1..407 1..407
CclAPx02 541 0 54..405 38..394
EglAPx08 543 0 39..403 72..443
CsAPx05 540 0 54..405 36..392
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2425201..2425329 129 N° 2 2424997..2425152 156 N° 3 2424824..2424944 121 N° 4 2424670..2424770 101
N° 5 2424538..2424625 88 N° 6 2424414..2424481 68 N° 7 2424279..2424365 87 N° 8 2424151..2424225 75
N° 9 2424015..2424092 78 N° 10 2423840..2423944 105 N° 11 2423734..2423793 60 N° 12 2423527..2423682 156
complement(join(2423527..2423682,2423734..2423793,2423840..2423944,2424015..2424 092,2424151..2424225,2424279..2424365,2424414..2424481,2424538..2424625,2424670. .2424770,2424824..2424944,2424997..2425152,2425201..2425329))


exon

Literature and cross-references SmAPx04-1_7 (SmAPx04a_7)
DNA ref. Phytozome 11:   scaffold_7 (2425329..2423527)
mRNA ref. JGI transcript:   85469 [Incorrect prediction]
EST ref. GenBank:   FE507096.1 [5' end]   FE507095.1 [3' end]
Cluster/Prediction ref. UniGene:   Smo.1505
Protein sequence: SmAPx04-1_7 (SmAPx04a_7)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   407
PWM (Da):   %s   44572.14 Transmb domain:   %s   o384-406i
PI (pH):   %s   9.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSLADARVPAWDVRAGVAPSKKNAAVKREFKSNFFQSSAVAKVATIAPRKLRRRALVISNSSSTSVKLSANDLEEAKLAVKELVQNTYSNPILIRLGWHDAGTYNKDIKEWPKCGGANGSVRFTKEMGHAANAGLQGALKLLDPIKDKFPAISYADLFQLASVTAILAGGPKIPMRYGRVDTTTPEECPEEGMLPDAGAPSPAEHLRKVFYRMGFNDEIVALSGAHTLGRARPNRSGWGKDETKYTKDGPGLPGGQSWTVHWLKFDNSYFREVKEKRDAELLVLPTDAALFEDPSFKVYAEKYAEDQETFFKDYAEAHAKLSELGAKFDPPEGITLEAAPQKFVAAEYSTPKKELSDSMKQKIRAEYLGLGGSPDQPLKTNYFLNIIVIIAVLAILTWLFGGF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns) and ESTs. ESTs from the two are compiled in the same unigene. Incorrect prediction from JGI (first exon is incorrectly predicted)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTATCTTTAGCTGACGCTAGAGTTCCAGCTTGGGATGTGCGAGCCGGAGTCGCGCCCAGCAAGAAGAATGCGGCTGTCAAGCGAGAATTTAAGTCGAATTTCTTTCAGTCATCT
GCTGTGGCG
GTAAGATTTTTCTTCGTTTCTTCTGCCTCTCAGTGTAGAGTGGTGCAGAAAGTAGCAACGATTGCTCCAAGAAAACTTCGGCGGAGAGCACTAGTGATCAGTAACAGTTCT
TCGACGTCCGTCAAGCTATCAGCGAATGATCTCGAAGAAGCCAAATTGGCGGTGAAGGAGCTCGTCCAGAATACGTATAGTAATCCAATCCTG
GTAAAGTTTCTTCGAGAAATTTCATTG
TCACCTTCTTTGGTTTCGTTTGTAGATTCGCTTGGGGTGGCATGACGCAGGAACTTATAACAAAGATATCAAAGAGTGGCCAAAATGCGGTGGCGCAAATGGGAGTGTACGATTTACGAA
GGAGATGGGTCACGCTGCCAATGCCG
GTACTGCCTTGTTCATTTCAACTTACTTTTGAACTGGGTGAATGTATTGTCAGGCCTCCAAGGCGCACTGAAACTTCTGGATCCTATCAAAGAT
AAATTCCCTGCGATAAGCTATGCAGATTTGTTCCAACTTGCGAGCGTCACTGCGATAGAG
GTAACCCCCGTTTATGAAACATGCTGTTATTCAAGTTATTGCAGCTAGCGGGAGGTCCTA
AAATACCGATGCGATACGGAAGAGTGGATACGACTACTCCAGAAGAATGTCCGGAAGAAGGAATGCTTCCTG
GTTCGTAAAATTCTTTCTAACAACTGTGCGTTTTTACATTTGATCTTT
TTCTTTAGATGCTGGAGCTCCAAGTCCTGCCGAACATCTTCGGAAGGTATTTTACAGAATGGGGTTTAACGACAAGGTACATAGATCATAGATAGAGAACTTTAGTTGTTTACATGTTGA
ACAGGAAATTGTTGCTTTATCGGGTGCTCACACACTCGGCAGGGCTCGGCCGAATAGAAGTGGATGGGGCAAAGATGAAACCAAATATACAGTAATGTAGCATCTACGACGTGTTCTTAC
TAAACAGTGAATCATTTTATGCAGAAAGATGGTCCAGGACTACCTGGCGGGCAGTCATGGACCGTACATTGGCTGAAGTTTGACAACTCCTATTTCAGGGTATGCCTTTACCTTGGTTTT
TAATACTCTGATCACAATAATCCTCTCGGAGGTGTAGGAAGTAAAAGAGAAACGAGATGCAGAATTACTTGTACTGCCAACGGATGCGGCTCTCTTTGAGGATCCCAGCTTTAAGGTGCG
GAATGTGCTTCGCAGTTCAGTTTCTACTTCATGAAAACGGTCTGAGTTTATAAAGTTGGACGCAGGTGTATGCTGAAAAGTATGCAGAGGATCAAGAAACTTTCTTCAAAGACTACGCAG
AAGCTCATGCCAAGCTTAGTGAGCTAGGTGCTAAATTCGATCCACCCGAG
GTAAATGATCTAGGTTTTGAAAGACATTACAATACTCTCACTGCAGGGCATTACGCTTGAGGCTGCTCCT
CAAAAGTTCGTTGCTGCCGAATACTCAACTCCGAAG
GTGCCTTTTCTTACTTGGCTGTATGCACTGACCATCATCTGTTGTTTGCAGAAAGAGCTCTCTGATTCCATGAAGCAGAAAATC
CGTGCTGAATACCTTGGGCTTGGTGGAAGTCCAGACCAGCCTTTGAAGACGAACTACTTTCTGAACATTATAGTCATCATTGCGGTTCTTGCTATTCTGACGTGGCTATTCGGTGGGTTT
TAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTATCTTTAGCTGACGCTAGAGTTCCAGCTTGGGATGTGCGAGCCGGAGTCGCGCCCAGCAAGAAGAATGCGGCTGTCAAGCGAGAATTTAAGTCGAATTTCTTTCAGTCATCT
GCTGTGGCG
AAAGTAGCAACGATTGCTCCAAGAAAACTTCGGCGGAGAGCACTAGTGATCAGTAACAGTTCTTCGACGTCCGTCAAGCTATCAGCGAATGATCTCGAAGAAGCCAAATTG
GCGGTGAAGGAGCTCGTCCAGAATACGTATAGTAATCCAATCCTG
ATTCGCTTGGGGTGGCATGACGCAGGAACTTATAACAAAGATATCAAAGAGTGGCCAAAATGCGGTGGCGCAAAT
GGGAGTGTACGATTTACGAAGGAGATGGGTCACGCTGCCAATGCCG
GCCTCCAAGGCGCACTGAAACTTCTGGATCCTATCAAAGATAAATTCCCTGCGATAAGCTATGCAGATTTGTTC
CAACTTGCGAGCGTCACTGCGATAGAG
CTAGCGGGAGGTCCTAAAATACCGATGCGATACGGAAGAGTGGATACGACTACTCCAGAAGAATGTCCGGAAGAAGGAATGCTTCCTGATGCT
GGAGCTCCAAGTCCTGCCGAACATCTTCGGAAGGTATTTTACAGAATGGGGTTTAACGACAAG
GAAATTGTTGCTTTATCGGGTGCTCACACACTCGGCAGGGCTCGGCCGAATAGAAGT
GGATGGGGCAAAGATGAAACCAAATATACA
AAAGATGGTCCAGGACTACCTGGCGGGCAGTCATGGACCGTACATTGGCTGAAGTTTGACAACTCCTATTTCAGGGAAGTAAAAGAGAAA
CGAGATGCAGAATTACTTGTACTGCCAACGGATGCGGCTCTCTTTGAGGATCCCAGCTTTAAG
GTGTATGCTGAAAAGTATGCAGAGGATCAAGAAACTTTCTTCAAAGACTACGCAGAA
GCTCATGCCAAGCTTAGTGAGCTAGGTGCTAAATTCGATCCACCCGAG
GGCATTACGCTTGAGGCTGCTCCTCAAAAGTTCGTTGCTGCCGAATACTCAACTCCGAAGAAAGAGCTCTCT
GATTCCATGAAGCAGAAAATCCGTGCTGAATACCTTGGGCTTGGTGGAAGTCCAGACCAGCCTTTGAAGACGAACTACTTTCTGAACATTATAGTCATCATTGCGGTTCTTGCTATTCTG
ACGTGGCTATTCGGTGGGTTTTAG

Retrieve as FASTA