Entry information : SmAPx04-2_36 (SmAPx04b_36)
Entry ID 7201
Creation 2010-02-10 (Christophe Dunand)
Last sequence changes 2010-02-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmAPx04-2_36 (SmAPx04b_36)
Name (synonym) SmAPx04-2_36 (SmAPx04b_36)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx04-2_36
start..stop
S start..stop
SmAPx04-1_7 830 0 1..407 1..407
CclAPx02 538 0 54..405 38..394
EglAPx08 540 0 39..403 72..443
CsAPx05 538 0 54..405 36..392
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1259197..1259325 129 N° 2 1259374..1259529 156 N° 3 1259582..1259702 121 N° 4 1259756..1259856 101
N° 5 1259901..1259988 88 N° 6 1260045..1260112 68 N° 7 1260161..1260247 87 N° 8 1260301..1260375 75
N° 9 1260425..1260502 78 N° 10 1260573..1260677 105 N° 11 1260725..1260784 60 N° 12 1260836..1260991 156
join(1259197..1259325,1259374..1259529,1259582..1259702,1259756..1259856,1259901 ..1259988,1260045..1260112,1260161..1260247,1260301..1260375,1260425..1260502,12 60573..1260677,1260725..1260784,1260836..1260991)


exon

Literature and cross-references SmAPx04-2_36 (SmAPx04b_36)
DNA ref. Phytozome 11:   scaffold_36 (1259197..1260991)
mRNA ref. JGI transcript:   108251 [Incorrect prediction]
EST ref. GenBank:   FE471758.1 [5' end]   FE457086.1 [3' end]
Cluster/Prediction ref. UniGene:   Smo.1505
Protein sequence: SmAPx04-2_36 (SmAPx04b_36)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   407
PWM (Da):   %s   44574.17 Transmb domain:   %s   o384-406i
PI (pH):   %s   9.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSLADARVPAWDVRAGVAPSKKNAAVKREFKSNFFQSSAVAKVATIAPRKLRRRALVISNSSSTSVKLSANDLEEAKLAVKELVQNTHSNPILIRLGWHDAGTYNKDIKEWPKCGGANGSIRFTKEMGHAANAGLQGALKLLDPIKDKFPAISYADLFQLASVTAILAGGPKIPMRYGRVDTTTPEECPEEGMLPDAGAPSPAEHLRKVFYRMGFNDEIVALSGAHTLGRARPNRSGWGKDETKYTKDGPGLPGGQSWTVHWLKFDNSYFREVKEKRDAELLVLPTDAALFEDPSFKVYAEKYAEDQETFFKDYAEAHAKLSELGAKFDPPEGITLEAAPQKFVAAEYSTPKKELSDSMKQKIRAEYLGLGGSPEQPLKTNYFLNIIVIIAVLAILTWLFGGF*

Retrieve as FASTA  
Remarks Completes sequence from genomic (11 introns) and 8 ESTs. ESTs from the two are compiled in the same unigene. Incorrect prediction from JGI (first exon is incorrectly predicted)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTATCTTTAGCTGACGCTAGAGTTCCAGCTTGGGATGTGCGAGCCGGAGTCGCGCCCAGCAAGAAGAATGCGGCTGTCAAGCGAGAATTTAAGTCGAATTTCTTTCAGTCATCC
GCTGTGGCG
GTAAGATTTTTCTTCGTTTCTTCTGCCTCTCAGTGTAGAGTGGTGCAGAAAGTAGCAACGATTGCTCCAAGAAAACTTCGGCGGAGAGCACTAGTGATCAGTAACAGTTCT
TCGACGTCAGTCAAGCTATCAGCGAATGATCTCGAAGAAGCCAAATTGGCGGTGAAGGAGCTCGTCCAAAATACGCATAGCAATCCAATCCTG
GTAAAGTTTCTTCGAGAAATTTCATTG
TCACCTTCTTTGGTTTCGTTTGTAGATTCGCTTGGGGTGGCATGACGCAGGAACTTATAACAAAGATATCAAAGAGTGGCCAAAATGCGGTGGTGCAAATGGGAGTATACGATTTACGAA
GGAGATGGGTCACGCTGCCAATGCCG
GTACTGCCTTGTTCGTTTCAACTTACTTTTGAACTGGGTGAATGTATTGTCAGGCCTCCAAGGCGCACTGAAACTTCTGGATCCTATCAAAGAT
AAATTCCCTGCGATAAGCTATGCAGATTTGTTCCAACTTGCGAGCGTCACTGCGATAGAG
GTAACCCCCGTTTATGAAACATGCTGTTATTCAAGTTATTGCAGCTAGCGGGAGGTCCTA
AAATACCGATGCGATACGGAAGAGTGGATACGACTACTCCAGAAGAATGTCCGGAAGAAGGAATGCTTCCTG
GTTCGTAAAATTCTTTCTAACAACTGTGCGTTTTTACATTTAATCTTT
TTCTTTAGATGCTGGAGCTCCAAGTCCTGCCGAACATCTTCGGAAGGTATTTTACAGAATGGGGTTTAACGACAAGGTACATAGATCATAGATAGAGAACTTTAGTTGTTTACATGTTGA
ACAGGAAATTGTTGCTTTATCGGGTGCTCACACGCTCGGCAGGGCTCGGCCGAATAGAAGTGGATGGGGCAAAGATGAAACCAAATATACAGTAATGTAGCATCTACTACGTGTTCTTAC
TAAACAGTGAATCATTTTATGCAGAAAGATGGTCCAGGACTACCTGGCGGGCAGTCATGGACCGTACATTGGCTGAAGTTTGACAACTCCTATTTCAGGGTATGCCTTTACCTTGGTTCT
GATCACAATAATCCTCTCGGAGGTGTAGGAAGTAAAAGAGAAACGAGATGCAGAATTACTTGTACTGCCAACGGATGCGGCTCTCTTTGAGGATCCCAGCTTTAAGGTGCGGAATGTGCT
TCACAGTTCAGTTTCTACTTCATGAAAACGGTCTGAGTTTATAAAGTTGGAGGCAGGTGTATGCTGAAAAGTATGCAGAGGATCAAGAAACTTTCTTCAAAGACTACGCAGAAGCTCATG
CCAAACTTAGTGAGCTAGGTGCTAAATTCGATCCACCCGAG
GTAAATGATCTAGTTTTTGAGAAAACTTTACAATACTCTCACTGCAGGGCATTACGCTTGAGGCTGCTCCTCAAAAGTT
CGTTGCTGCCGAATACTCAACTCCGAAG
GTGCCTTTTCTTACTTGGCTGTATGCACCGACCATCATCTGTTGTTTGCAGAAAGAGCTCTCTGATTCCATGAAGCAGAAAATCCGTGCTGA
ATACCTTGGGCTTGGTGGAAGTCCAGAGCAGCCTTTGAAGACAAACTACTTTCTGAACATTATAGTCATCATTGCGGTTCTTGCTATTCTGACGTGGCTATTCGGTGGGTTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTATCTTTAGCTGACGCTAGAGTTCCAGCTTGGGATGTGCGAGCCGGAGTCGCGCCCAGCAAGAAGAATGCGGCTGTCAAGCGAGAATTTAAGTCGAATTTCTTTCAGTCATCC
GCTGTGGCG
AAAGTAGCAACGATTGCTCCAAGAAAACTTCGGCGGAGAGCACTAGTGATCAGTAACAGTTCTTCGACGTCAGTCAAGCTATCAGCGAATGATCTCGAAGAAGCCAAATTG
GCGGTGAAGGAGCTCGTCCAAAATACGCATAGCAATCCAATCCTG
ATTCGCTTGGGGTGGCATGACGCAGGAACTTATAACAAAGATATCAAAGAGTGGCCAAAATGCGGTGGTGCAAAT
GGGAGTATACGATTTACGAAGGAGATGGGTCACGCTGCCAATGCCG
GCCTCCAAGGCGCACTGAAACTTCTGGATCCTATCAAAGATAAATTCCCTGCGATAAGCTATGCAGATTTGTTC
CAACTTGCGAGCGTCACTGCGATAGAG
CTAGCGGGAGGTCCTAAAATACCGATGCGATACGGAAGAGTGGATACGACTACTCCAGAAGAATGTCCGGAAGAAGGAATGCTTCCTGATGCT
GGAGCTCCAAGTCCTGCCGAACATCTTCGGAAGGTATTTTACAGAATGGGGTTTAACGACAAG
GAAATTGTTGCTTTATCGGGTGCTCACACGCTCGGCAGGGCTCGGCCGAATAGAAGT
GGATGGGGCAAAGATGAAACCAAATATACA
AAAGATGGTCCAGGACTACCTGGCGGGCAGTCATGGACCGTACATTGGCTGAAGTTTGACAACTCCTATTTCAGGGAAGTAAAAGAGAAA
CGAGATGCAGAATTACTTGTACTGCCAACGGATGCGGCTCTCTTTGAGGATCCCAGCTTTAAG
GTGTATGCTGAAAAGTATGCAGAGGATCAAGAAACTTTCTTCAAAGACTACGCAGAA
GCTCATGCCAAACTTAGTGAGCTAGGTGCTAAATTCGATCCACCCGAG
GGCATTACGCTTGAGGCTGCTCCTCAAAAGTTCGTTGCTGCCGAATACTCAACTCCGAAGAAAGAGCTCTCT
GATTCCATGAAGCAGAAAATCCGTGCTGAATACCTTGGGCTTGGTGGAAGTCCAGAGCAGCCTTTGAAGACAAACTACTTTCTGAACATTATAGTCATCATTGCGGTTCTTGCTATTCTG
ACGTGGCTATTCGGTGGGTTTTAG

Retrieve as FASTA