Entry information : ZmPrx26
Entry ID 722
Creation 2006-02-02 (Christophe Dunand)
Last sequence changes 2006-02-02 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx26
Name ZmPrx26
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Roots
Seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx26
start..stop
S start..stop
SofPrx09 647 0 16..345 13..340
SbPrx128 644 0 9..345 5..344
SiPrx39 620 0 9..345 4..334
HvPrx16 600 0 15..345 9..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 118789925..118790191 267 N° 2 118789655..118789846 192 N° 3 118789401..118789566 166 N° 4 118788889..118789301 413
complement(join(118788889..118789301,118789401..118789566,118789655..118789846,1 18789925..118790191))


exon

Literature and cross-references ZmPrx26
Literature Hainey,C.F. et al., unpublished
Protein ref. UniProtKB:   B4FD28 [3' end]   B4F815 [Incorrect splicing]   B6U2S5 [Incorrect splicing]
DNA ref. GenBank:   AC209629.2 (17554..16255)
mRNA ref. GenBank:   AY106495
Cluster/Prediction ref. UniGene:   Zm.3932
Protein sequence: ZmPrx26
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (307)
PWM (Da):   %s   37375.3 (33660.3) Transmb domain:   %s   i13-35o
PI (pH):   %s   4.79 (4.59) Peptide Signal:   %s   cut: 39 range:39-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRASATAGVLRFVRAFALCVATACLLLAAGMPSPVAAQDPSKLSLQYYSKTCPNVEHVVRTEMECAVRADTRNAALMLRLHFHDCFVQGCDGSVLLDDTATMIGEKQAEQNVNSLKGFDLVDKIKEKLEAECPGTVSCADLLAIAARDAVVLVGGPYWDVPVGRLDSKKASLDLANSDIPTAQQGLLTLIAKFWEKGLDATDMVALVGSHTIGFARCENFRDRIYGDFEMTSKYNPSSEAYLSKLKEVCPRDGGDDNISAMDSHTSDVFDNAYFETLIKGEGLLNSDQAMWSSIAGYSTSDTVNKYWADPEAFFKQFSDSMVKMGNITNPAGGEVRKTCRFVNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns) and 52 ESTs. Also found in AC203775.3.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCCGCGCCAGCGCCACAGCAGGTGTGTTGCGCTTCGTCAGGGCGTTCGCCCTCTGCGTGGCTACGGCATGCCTCCTCCTGGCGGCCGGCATGCCCTCGCCTGTGGCGGCGCAGGAC
CCGTCGAAGCTGAGCCTGCAGTACTACTCCAAGACGTGCCCCAACGTGGAGCACGTCGTCCGGACGGAGATGGAGTGCGCGGTGCGCGCCGACACGCGCAACGCCGCGCTCATGCTCCGC
CTCCATTTCCATGACTGCTTCGTGCAG
GTGATCAGTCGGTCCCTCCTATATATATCAGCTAATGCAGCAGCAGCAGCTAGCTGATGTCATCGTCCTAATTTGCAGGGCTGCGACGGGTCG
GTGCTGCTCGACGACACGGCAACCATGATCGGAGAGAAGCAGGCGGAGCAGAACGTCAACTCGCTGAAAGGGTTCGATCTGGTTGACAAGATCAAGGAGAAGCTGGAAGCCGAGTGCCCT
GGAACCGTCTCCTGCGCAGACCTGCTGGCGATTGCAGCTAGGGATGCGGTTGTGCTG
GTAACCAGACCACACCACACCTTTCAATCCTGCATCCAGCGATCGACCAGATCAACCGAGTAT
CGACTGCAAACTGTATGTGTTGCAGGTTGGTGGGCCTTACTGGGATGTCCCAGTAGGAAGACTGGACTCCAAGAAGGCGAGCCTGGACCTAGCAAACAGCGACATCCCTACGGCCCAGCA
AGGCCTCCTCACGCTCATTGCCAAGTTCTGGGAGAAGGGCCTTGATGCCACTGACATGGTGGCCCTCGTCG
GTAGGTTACCAAACTAAAACCACCATCAGGACTTGTAAATGTCACTACA
GTTTGTGTAAATGTGTGCATGTTTACTTTTCTTTCCAACAAAAAAAAAAGGATCCCACACGATCGGATTCGCTAGGTGCGAGAATTTCCGGGACAGAATCTACGGCGACTTCGAGATGAC
GTCCAAGTACAACCCGTCGTCCGAGGCCTACCTGAGCAAGCTGAAGGAGGTGTGCCCGCGGGACGGCGGCGACGACAACATCAGCGCCATGGACAGCCACACCTCCGACGTGTTCGACAA
CGCCTACTTCGAGACCCTCATCAAGGGCGAGGGCCTGCTCAACTCCGACCAGGCGATGTGGTCCAGCATCGCGGGCTACTCCACCTCCGACACAGTCAACAAGTACTGGGCCGACCCCGA
GGCCTTCTTCAAGCAGTTCTCCGACTCCATGGTGAAGATGGGCAACATCACCAACCCTGCCGGCGGCGAGGTCAGGAAGACCTGCAGATTTGTCAACACATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCCGCGCCAGCGCCACAGCAGGTGTGTTGCGCTTCGTCAGGGCGTTCGCCCTCTGCGTGGCTACGGCATGCCTCCTCCTGGCGGCCGGCATGCCCTCGCCTGTGGCGGCGCAGGAC
CCGTCGAAGCTGAGCCTGCAGTACTACTCCAAGACGTGCCCCAACGTGGAGCACGTCGTCCGGACGGAGATGGAGTGCGCGGTGCGCGCCGACACGCGCAACGCCGCGCTCATGCTCCGC
CTCCATTTCCATGACTGCTTCGTGCAG
GGCTGCGACGGGTCGGTGCTGCTCGACGACACGGCAACCATGATCGGAGAGAAGCAGGCGGAGCAGAACGTCAACTCGCTGAAAGGGTTCGAT
CTGGTTGACAAGATCAAGGAGAAGCTGGAAGCCGAGTGCCCTGGAACCGTCTCCTGCGCAGACCTGCTGGCGATTGCAGCTAGGGATGCGGTTGTGCTG
GTTGGTGGGCCTTACTGGGAT
GTCCCAGTAGGAAGACTGGACTCCAAGAAGGCGAGCCTGGACCTAGCAAACAGCGACATCCCTACGGCCCAGCAAGGCCTCCTCACGCTCATTGCCAAGTTCTGGGAGAAGGGCCTTGAT
GCCACTGACATGGTGGCCCTCGTCG
GATCCCACACGATCGGATTCGCTAGGTGCGAGAATTTCCGGGACAGAATCTACGGCGACTTCGAGATGACGTCCAAGTACAACCCGTCGTCCGAG
GCCTACCTGAGCAAGCTGAAGGAGGTGTGCCCGCGGGACGGCGGCGACGACAACATCAGCGCCATGGACAGCCACACCTCCGACGTGTTCGACAACGCCTACTTCGAGACCCTCATCAAG
GGCGAGGGCCTGCTCAACTCCGACCAGGCGATGTGGTCCAGCATCGCGGGCTACTCCACCTCCGACACAGTCAACAAGTACTGGGCCGACCCCGAGGCCTTCTTCAAGCAGTTCTCCGAC
TCCATGGTGAAGATGGGCAACATCACCAACCCTGCCGGCGGCGAGGTCAGGAAGACCTGCAGATTTGTCAACACATAG

Retrieve as FASTA