Entry information : ZmPrx28 (Peroxidase 66)
Entry ID 724
Creation 2005-06-13 (Christophe Dunand)
Last sequence changes 2005-06-13 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx28 (Peroxidase 66)
Name (synonym) ZmPrx28 (Peroxidase 66)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Apical meristems
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx28
start..stop
S start..stop
SbPrx23_BTx623 555 0 10..329 15..333
SofPrx03 554 0 23..329 27..330
SiPrx154 518 0 4..329 9..331
OsPrx33 489 4e-176 21..329 3..311
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4604108..4604326 219 N° 2 4603718..4603906 189 N° 3 4601425..4602006 582  
complement(join(4601425..4602006,4603718..4603906,4604108..4604326))


exon

Literature and cross-references ZmPrx28 (Peroxidase 66)
Literature Chen,H.D., Zhang,X., Zhou,R.L., Arias L,A.C., Shendelman,J.M., Zazubovits,N., Borsuk,L.A., Emrich,S.J., Ashlock,D.A., Scanlon,M.J. and Schnable,P.S. Expressed Sequence Tags from B73 Maize Shoot Apical Meristems. Unpublished (2004).
Protein ref. UniProtKB:   B4FNL8   B4FAL5 [Incorrect splicing]   B4FLI3 [Incorrect splicing]   B6TFD7 [Incorrect splicing]
DNA ref. GenBank:   AC191256.3 (39133..36235)
Cluster/Prediction ref. UniGene:   Zm.19224
Protein sequence: ZmPrx28 (Peroxidase 66)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   33357.64 (30950.3)  
PI (pH):   %s   4.85 (4.60) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVGRGAATALVWAAVVAVATVVSRAQQLQVGFYDTLCPAAEIIVQEEVSKAASGNPGVAAGLLRLHFHDCFVRGCDASVLLDSSAGNQAEKDAAPNASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVPAGRRDGNVSSAQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGAHTVGAARCSSFAPRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPLPMDPVTPTAFDTNYYANLVARRGLLASDQALLADPATAAQVLAYTNSPATFQTDFVAAMIKMGAIQVLTGTAGTVRTNCRVAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, introns 1 and 2) and 275 ESTs. Also found in AC155424.2. Cultivar="B73"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGGACGAGGAGCGGCGACGGCCCTCGTGTGGGCGGCGGTGGTGGCGGTCGCGACGGTGGTGTCGCGGGCGCAGCAGCTGCAGGTGGGGTTCTACGACACGCTGTGCCCGGCGGCG
GAGATCATCGTGCAGGAGGAGGTGAGCAAGGCGGCGTCCGGCAACCCCGGCGTCGCCGCGGGCCTCCTGCGCCTCCACTTCCACGACTGCTTCGTCAGG
GTCAGTGCGCCAAGCGGCTAA
TTATTAAGCAAGCTAGCTAGCCGCCCTCCTCGAGTGATCCAATGCAAAGTGGTTGGTGGTGGCGGTGGTGGTGTCACGTACTGTGGGGACGGGCCGGCCGGGTGCCTCGATTGCGCGCGT
AGCTGCATGTGGATCCTCCTTCCTCTCTGTTCATTATTACGCGTATTATTGGTATTGCAGGGGTGCGACGCGTCGGTGCTGCTGGACTCGTCGGCGGGCAACCAGGCGGAGAAGGACGCG
GCGCCCAACGCCAGCCTGCGCGGGTTCGAGGTCATCGACAGCGCCAAGACGCGGCTGGAGCAGGCCTGCTTCGGCGTCGTCTCCTGCGCCGACGTCCTCGCCTTCGCCGCCCGCGACGCC
CTCGCGCTG
GTACGCACTGCTCGTCCCCTCACTAGCTAGCTGCTCTTCCACTAGCTAGCAGCTTCTCCGGTTCTCTTTGGTCAGCGCTAGGTAACAACGTAACAAAACTATTCCCATCCC
AAGGTAGAGCGAAATCGGTCTAGGATCACGCGCAGTGAGTACGTACGTGAGTGAAGAGGCATGGCCCAGCCGCGCCTTTCTGGACGCTTCCTTTCTTTTTCATCAAATATAAAAGGATGT
GGGGGATGGATGGTTGCCATGAAAGCAGCTTTGGAATGGAAGGCTGTCCAGCCTTTGGCAACTCCACCCAACAATGCCATGTCCTGCACTGCACTGCACGTACTGCCTCGGAAGCAAGCA
CGCACGGCCGGCACACGGTGGTATAGATGGCCAAAAAGCACGAGGCCCGTGAGCCCGGCACGAAGCCCGCTTTTTGGGCCCGGTCCGAGCCCGGCACGGTAAAATAAGTGGGCGGGCTTG
GACAGGAAACTAGGCACGGCGGGCTAGCCCGGCACGGCCCGTTTACCTCTAAGCCCGTTAAGCCCGTTTTTTTACACTAAAACGTGCTTTTCGGCCTGTTTAGCCCGCTTTTTGGTCCGT
TTTTTCGTGCTAAACGGGCCGGCCCGGCCCGTTTAGGCCCGCTACGGGCCGGGCTTGGACAGAAACTTAAGCCCGATGGCTCAGCAGGCCCGGCCCGGTTTTGGCCGGGCTTCACCGGGC
CCGGGCCGGGCCGGGCCGGGCCGGCCCGTTTGGCCATCTCTACACGGTGGCAGAGAGGAGAGAAGGTGACTCGAGGCGAGCCGTCCTTTTGCTTTAGGTGCACCTCGGTTTTGCTTGGCT
CGGTTCGTACGTTACCGCGCGCACGGGCCTAACCTAACGGCCGGTGGGTGTCCGTAGCAGCGGCGGCACATGCTCGTGTCGTCGTGTCGCCCTCCATGGCTCAGCATAGCTCCAGTTCCC
TCGAAAACCTTCTTCTGGAGGTGAGGATGGCATTAGGAGCTGGGAGAGTGCACTGCACTGCTCAGCGGTAGGGATTCTCCACTTGCCTTGGGCTTCGATTCAGCTGATTCTATGGCAGGA
TCAAACCTGCTGGTCAACAGATTTGATACGGTTAAGCCAACAGATATAGCCTTCAGTGTTAAACTAAACATGCTGCTTGCTCGAAGTTGCTGCTACAGTTTTTTTCCTTTTTCTTTTTTG
TTGGGAACCATCAGCTCAGCAGGCGAGAGGAGAGTGAGGTCGGTGTCACACCGTCGTCACTCGTGGCAGTTGCAGGTAGCCCAGAGAGCGTAGCGTAGGCAGCAGAACTTTCCATTTCCC
AGCTGCCAAACAGAGCACGCCGCTATACCTGACACGGAACCGTCGCGTCGAGCCAGCCACCGTGACAATACGGCGGCGGTTTCACGTCCGTGTCTCGTGACCGGGAGGGAGAGGCAGGAG
CGAAAGCTACGAGACTACTACCACTACCAGCGCGGCGGCCTCGGGAACGCGGCGTGGGCACGTCGGGCGCATGGTTCTAGTACGTGGATCCGACGCGCACCCCATGTGCTCTGCCCTGCC
CGGGCCCGGCACGCCCACATGCCCTGCCGTCGCGGTCTCGCCCGCCCCACCGGACGTTCCGGGTCCGCACGCACGTGCCACCTCAGCTGGCGTTCGCGTCGCGTTGGCTGCCTTCTCTTG
CTGACGCTTCTGTGTTGGTCTCTGGCTGCGTTTGTTGCAGGTCGGGGGCGACGCGTACCAGGTGCCGGCGGGGCGGAGGGACGGCAACGTCTCCTCGGCGCAGGAGGCGGGCGCGAACCT
GCCGCCGCCGACGGCGAGCGCGAGCCAGCTGACGCAGGCGTTCGGCGCCAAGGGGCTGAGCCAGGCCGAGATGGTGGCGCTGTCGGGGGCGCACACGGTGGGCGCGGCGCGCTGCAGCTC
CTTCGCGCCCCGCCTCTACTCGTACGGGCCCAGCGGCGCGGGGCAGGACCCGTCCATGGACCCCGCGTACCTGGCGGCGCTGGCGCAGCAGTGCCCGCCGCAGGGGACCGGCGCCGCCGA
CCCGCCCCTCCCCATGGACCCCGTCACGCCCACCGCCTTCGACACCAACTACTACGCCAACCTGGTCGCCAGGCGCGGCCTGCTCGCCTCCGACCAGGCGCTGCTCGCCGACCCGGCCAC
CGCCGCGCAGGTGCTCGCCTACACCAACAGCCCCGCCACCTTCCAGACCGACTTCGTCGCCGCCATGATCAAGATGGGTGCCATACAGGTGCTCACCGGCACAGCCGGCACCGTCCGGAC
CAACTGCAGGGTGGCTAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGGACGAGGAGCGGCGACGGCCCTCGTGTGGGCGGCGGTGGTGGCGGTCGCGACGGTGGTGTCGCGGGCGCAGCAGCTGCAGGTGGGGTTCTACGACACGCTGTGCCCGGCGGCG
GAGATCATCGTGCAGGAGGAGGTGAGCAAGGCGGCGTCCGGCAACCCCGGCGTCGCCGCGGGCCTCCTGCGCCTCCACTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGGTGCTG
CTGGACTCGTCGGCGGGCAACCAGGCGGAGAAGGACGCGGCGCCCAACGCCAGCCTGCGCGGGTTCGAGGTCATCGACAGCGCCAAGACGCGGCTGGAGCAGGCCTGCTTCGGCGTCGTC
TCCTGCGCCGACGTCCTCGCCTTCGCCGCCCGCGACGCCCTCGCGCTG
GTCGGGGGCGACGCGTACCAGGTGCCGGCGGGGCGGAGGGACGGCAACGTCTCCTCGGCGCAGGAGGCGGGC
GCGAACCTGCCGCCGCCGACGGCGAGCGCGAGCCAGCTGACGCAGGCGTTCGGCGCCAAGGGGCTGAGCCAGGCCGAGATGGTGGCGCTGTCGGGGGCGCACACGGTGGGCGCGGCGCGC
TGCAGCTCCTTCGCGCCCCGCCTCTACTCGTACGGGCCCAGCGGCGCGGGGCAGGACCCGTCCATGGACCCCGCGTACCTGGCGGCGCTGGCGCAGCAGTGCCCGCCGCAGGGGACCGGC
GCCGCCGACCCGCCCCTCCCCATGGACCCCGTCACGCCCACCGCCTTCGACACCAACTACTACGCCAACCTGGTCGCCAGGCGCGGCCTGCTCGCCTCCGACCAGGCGCTGCTCGCCGAC
CCGGCCACCGCCGCGCAGGTGCTCGCCTACACCAACAGCCCCGCCACCTTCCAGACCGACTTCGTCGCCGCCATGATCAAGATGGGTGCCATACAGGTGCTCACCGGCACAGCCGGCACC
GTCCGGACCAACTGCAGGGTGGCTAGCTAG

Retrieve as FASTA