Entry information : ZmPrx29 (Peroxidase 73)
Entry ID 725
Creation 2005-12-15 (Christophe Dunand)
Last sequence changes 2005-12-15
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx29 (Peroxidase 73)
Name (synonym) ZmPrx29 (Peroxidase 73)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Ears
Seedlings
Silks
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx29
start..stop
S start..stop
SbPrx32 598 0 1..335 1..336
SiPrx123 562 0 1..335 1..329
OsPrx123 512 0 31..335 32..331
TaPrx13 458 9e-164 1..335 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 192376717..192376947 231 N° 2 192375711..192375902 192 N° 3 192375044..192375628 585  
complement(join(192375044..192375628,192375711..192375902,192376717..192376947))


exon

Literature and cross-references ZmPrx29 (Peroxidase 73)
Literature Gardiner,J., Schroeder,S., Polacco,M.L., Sanchez-Villeda,H., Fang,Z., Morgante,M., Landewe,T., Fengler,K., Useche,F., Hanafey,M., Tingey,S., Chou,H., Wing,R., Soderlund,C. and Coe,E.H. Jr. Anchoring 9,371 maize expressed sequence tagged unigenes to the bacterial artificial chromosome contig map by two-dimensional overgo hybridization. Plant Physiol. 134 (4), 1317-1326 (2004).
Protein ref. UniProtKB:   B4F8B7   B6U0T8
DNA ref. GenBank:   AC200703.3 (64112..66012)
mRNA ref. GenBank:   AY111875.1
Cluster/Prediction ref. UniGene:   Zm.1415
Protein sequence: ZmPrx29 (Peroxidase 73)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (305)
PWM (Da):   %s   35526.87 (32233.0) Transmb domain:   %s   i9-28o
PI (pH):   %s   6.59 (5.84) Peptide Signal:   %s   cut: 31 range:31-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKWRRRRHLLLAVAAVALVAAITLPSAEAKLSPDYYRSTCPDVEAIVQAVVAKKVNETFVTVPATLRLFFHDCFVEGCDASVIIASRDNDAEKDAPDNVSLAGDGFDTVVRAKAEVEKKCPGVVSCADILAIAARDVVTMSSGPHWTVQLGRLDGLVSKAGNVAGKLPGPNMRVKDLAALFAKHNLTTLDMVALSGAHTVGFAHCTRFADRLYHHGVGDSDGASVDPSYNPAYARQLMDACPPGVGADIAVNMDPITPTAFDNAYYANLAGGLGLFTSDQALYSDGASQPAVRDFAKNQTRFFEAFKDAMVKLGSVGVKTGRHGEIRSDCTAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2) and 35 ESTs. Cultivar="F2", "B73". Also found in AC211164.5.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAATGGAGAAGACGCAGGCACTTGCTGCTTGCTGTTGCAGCCGTGGCCCTGGTGGCAGCAATAACGCTGCCGTCCGCGGAGGCGAAGCTGTCCCCGGACTACTACCGGTCGACG
TGCCCGGACGTGGAGGCAATCGTGCAGGCAGTGGTGGCCAAGAAGGTGAATGAGACCTTCGTCACAGTCCCGGCCACGCTCAGGCTCTTCTTCCACGACTGCTTCGTCGAG
GTGAGCAAC
ATCCATCAGGCCATTCTGGCCTGCTCGCTGCAGCTACTCTTGCAGCGCCATGCTAGCTTTTGTTGCCGATTCCTGTGAAGATCTTGTGTTTTAAACACCTCGCTTTAGATTTTACCCATT
AAGCTTTCTCGATTTGCAGTCTCCTAGAGGTTTAGCTCGACAAGGCTTTTCAGATTCTTTCAGATCGACTTGCAGACTACTGCTCTTACTATTAGATCAGACTGAATTTTTAGATTTTAC
CTAGGCAATCATTTCATACTGAATTTTTAGATCAGACTGAATTTGGTAGTGTTAGTGGTACTAGATAGAAGAAAGACTATTGGTACGAATGACAGCTCGATTGTTGCCTTCTAATCACAC
ACTCGCCGGCTTGCCATGTGACTGCACGACATTTTCTGTCAACTAGGCTGAATTCTATCAGATATTCAGGTCAGATGTGTCGGGCGTCCCTGCTGGCAAATAATCCACCCATTTGTCATT
TTCCAACGAGTGGAATTCGGAATTGTACTCCTTGATTTTAAAAAGTCAGTTTATGCCAATAACCACTTCAGTTTGAAGGTACACTGTTCCAAGGATGGACATGGGTCTGTAAACTTTAGA
GCCAGAGCTCTGAATAAGTGGTCTAAAATTATCTTTAGATTTTAACCCACCTTATATTAAAGTTATAAAGTTTTATAGATAAAAGATAAACTAAAATGCTATAAGGTTTAAAAGTTTAGG
AGGGAATCCTGTCCTATATTTTCTACTAGTTTGCACGGGGTGAAATTGAAACTAACATTTATGTTTATGTTGAATCAACTTGCAGGGCTGTGATGCGTCGGTCATCATCGCGTCCCGCGA
CAACGACGCCGAGAAGGACGCGCCCGACAACGTGTCCCTCGCTGGCGACGGCTTCGACACCGTGGTGCGCGCCAAGGCCGAGGTCGAGAAGAAGTGCCCCGGCGTGGTCTCCTGCGCCGA
TATCCTCGCCATCGCCGCCAGGGACGTCGTCACCATG
GTAACTGTCTCACTTCTTACTGACTACTGAGCCATGCCATTTCGGTTTCTGATACTACTGTGCTTGTGCAACGGCATGGCAGT
CGTCCGGCCCCCACTGGACCGTCCAGCTTGGCCGGCTTGACGGGCTCGTCTCCAAGGCCGGCAACGTCGCGGGCAAGTTGCCGGGACCCAACATGCGCGTCAAGGACCTCGCCGCCCTGT
TCGCCAAGCACAACCTCACCACGCTCGACATGGTCGCGCTCTCGGGAGCGCACACCGTCGGGTTCGCGCACTGCACCCGCTTCGCGGACCGCCTCTACCACCACGGCGTCGGCGACAGCG
ATGGCGCGTCGGTGGACCCGTCGTACAACCCTGCGTACGCGCGGCAGCTAATGGACGCCTGCCCGCCTGGCGTCGGCGCAGACATCGCCGTCAATATGGACCCAATCACACCGACCGCCT
TCGATAACGCCTACTACGCCAACCTCGCCGGCGGCCTGGGATTGTTCACCTCGGACCAGGCGCTGTACAGCGACGGCGCGTCGCAACCGGCGGTGAGGGACTTCGCTAAGAACCAGACCC
GCTTCTTCGAGGCGTTCAAGGACGCCATGGTCAAGCTGGGCAGTGTTGGGGTGAAGACCGGCCGGCACGGGGAGATCAGGAGTGACTGCACTGCATTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAATGGAGAAGACGCAGGCACTTGCTGCTTGCTGTTGCAGCCGTGGCCCTGGTGGCAGCAATAACGCTGCCGTCCGCGGAGGCGAAGCTGTCCCCGGACTACTACCGGTCGACG
TGCCCGGACGTGGAGGCAATCGTGCAGGCAGTGGTGGCCAAGAAGGTGAATGAGACCTTCGTCACAGTCCCGGCCACGCTCAGGCTCTTCTTCCACGACTGCTTCGTCGAG
GGCTGTGAT
GCGTCGGTCATCATCGCGTCCCGCGACAACGACGCCGAGAAGGACGCGCCCGACAACGTGTCCCTCGCTGGCGACGGCTTCGACACCGTGGTGCGCGCCAAGGCCGAGGTCGAGAAGAAG
TGCCCCGGCGTGGTCTCCTGCGCCGATATCCTCGCCATCGCCGCCAGGGACGTCGTCACCATG
TCGTCCGGCCCCCACTGGACCGTCCAGCTTGGCCGGCTTGACGGGCTCGTCTCCAAG
GCCGGCAACGTCGCGGGCAAGTTGCCGGGACCCAACATGCGCGTCAAGGACCTCGCCGCCCTGTTCGCCAAGCACAACCTCACCACGCTCGACATGGTCGCGCTCTCGGGAGCGCACACC
GTCGGGTTCGCGCACTGCACCCGCTTCGCGGACCGCCTCTACCACCACGGCGTCGGCGACAGCGATGGCGCGTCGGTGGACCCGTCGTACAACCCTGCGTACGCGCGGCAGCTAATGGAC
GCCTGCCCGCCTGGCGTCGGCGCAGACATCGCCGTCAATATGGACCCAATCACACCGACCGCCTTCGATAACGCCTACTACGCCAACCTCGCCGGCGGCCTGGGATTGTTCACCTCGGAC
CAGGCGCTGTACAGCGACGGCGCGTCGCAACCGGCGGTGAGGGACTTCGCTAAGAACCAGACCCGCTTCTTCGAGGCGTTCAAGGACGCCATGGTCAAGCTGGGCAGTGTTGGGGTGAAG
ACCGGCCGGCACGGGGAGATCAGGAGTGACTGCACTGCATTCAACTAG

Retrieve as FASTA