Entry information : ZmPrx30 (GRMZM2G427954)
Entry ID 726
Creation 2007-11-19 (Christophe Dunand)
Last sequence changes 2011-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-20 (Christophe Dunand)
Peroxidase information: ZmPrx30 (GRMZM2G427954)
Name (synonym) ZmPrx30 (GRMZM2G427954)
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx30
start..stop
S start..stop
ZmPrx78 654 0 1..391 1..391
ZmPrx97 611 0 2..390 1..349
ZmPrx09 611 0 2..390 1..349
SbPrx37 606 0 1..390 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168814574..168814969 396 N° 2 168813674..168814453 780  
complement(join(168813674..168814453,168814574..168814969))


exon

Literature and cross-references ZmPrx30 (GRMZM2G427954)
Literature Hainey,C.F. et al., unpublished
DNA ref. GenBank:   AC206295.2 (36004..37284)
Protein sequence: ZmPrx30 (GRMZM2G427954)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   391 (368)
PWM (Da):   %s   41316.33 (38963.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.02 (5.66) Peptide Signal:   %s   cut: 24 range:24-391
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSPSKLAVLTVFAFALLGSVSCQAGTYYYTPPAPATPQPPACPPPVTPVPPPASPPTYPPPTPTSPPAPTPTPPPPPPPSSPGTQLMVGYYKNKCGAYVDVEAIVKKHVSATDAGMQAGLVRLFFHDCFVRGCDGSVLLDTFSNDTSLTPEKFGVPNFPSLRGFEVIDAAKAEMEAACPGTVSCADIVAFAARDASYFLSGGGISFAMPAGRYDGTVSLASETLPNLPPPFAGFDQLVKMFDDKGLDALDMITLSGAHSIGRSHCSSFTRDRLPPSNTTDMDPAFAATLQASCASANGTDNTVMQDFATPDVLDNQYYKNVLAHKVLFTSDAALTTNFTSNNLVRAYADFVPYLWQQKFAKAMVKMGGVEIKTAANGEIRKTCRKINSRP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1). No EST. Contig contains 6 other peroxidases. Also found in AC212733.4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGCCCTAGTAAGCTCGCCGTCCTCACTGTGTTCGCCTTCGCCCTGCTCGGCTCCGTGTCATGCCAGGCCGGAACCTACTACTACACTCCTCCGGCTCCGGCCACCCCGCAACCA
CCGGCATGTCCTCCTCCTGTCACTCCGGTGCCCCCGCCCGCGTCACCACCCACTTATCCTCCACCGACCCCGACGAGCCCACCCGCGCCTACGCCCACACCCCCACCCCCACCCCCACCC
AGCAGCCCTGGGACGCAACTCATGGTCGGATACTACAAGAACAAGTGTGGCGCTTACGTGGATGTCGAAGCTATTGTCAAGAAGCACGTCAGTGCCACTGATGCTGGTATGCAGGCCGGG
CTTGTCCGTCTCTTCTTCCACGACTGCTTCGTCCGT
GTAAGAGCTCCATTACCGACCAAGCTAGCCATGCATGCCGTACATACCATATTCATGCATGCAGTCAGACAGTTAATTGAAGGC
GTTGCCATCGCCATGTGTACGTGGTGGTTTCTGCAGGGATGCGACGGCTCCGTCCTCCTCGACACGTTCAGCAACGACACCAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACTTCCCC
AGCCTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCCGAGATGGAGGCGGCGTGCCCGGGCACGGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCATCCTACTTCCTC
AGCGGCGGCGGCATCAGCTTCGCCATGCCGGCGGGGCGCTACGACGGGACCGTCTCCCTCGCCAGCGAGACCCTCCCCAACCTGCCCCCGCCGTTCGCCGGCTTCGACCAGCTCGTCAAG
ATGTTCGACGACAAGGGGCTCGACGCCTTGGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACACCACC
GACATGGACCCAGCGTTCGCCGCCACGCTGCAGGCTAGCTGCGCGTCGGCCAACGGCACCGACAACACGGTGATGCAGGACTTCGCCACCCCTGACGTCCTGGACAACCAGTACTACAAG
AACGTGCTGGCCCACAAGGTTCTCTTCACGTCGGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTGCCCTATCTGTGGCAGCAGAAGTTC
GCGAAAGCCATGGTGAAGATGGGCGGCGTCGAGATCAAAACCGCCGCCAATGGAGAGATCAGGAAGACATGCCGCAAGATCAACAGCAGGCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGCCCTAGTAAGCTCGCCGTCCTCACTGTGTTCGCCTTCGCCCTGCTCGGCTCCGTGTCATGCCAGGCCGGAACCTACTACTACACTCCTCCGGCTCCGGCCACCCCGCAACCA
CCGGCATGTCCTCCTCCTGTCACTCCGGTGCCCCCGCCCGCGTCACCACCCACTTATCCTCCACCGACCCCGACGAGCCCACCCGCGCCTACGCCCACACCCCCACCCCCACCCCCACCC
AGCAGCCCTGGGACGCAACTCATGGTCGGATACTACAAGAACAAGTGTGGCGCTTACGTGGATGTCGAAGCTATTGTCAAGAAGCACGTCAGTGCCACTGATGCTGGTATGCAGGCCGGG
CTTGTCCGTCTCTTCTTCCACGACTGCTTCGTCCGT
GGATGCGACGGCTCCGTCCTCCTCGACACGTTCAGCAACGACACCAGCCTGACCCCGGAGAAGTTCGGCGTGCCCAACTTCCCC
AGCCTGCGGGGCTTCGAGGTGATCGACGCGGCCAAAGCCGAGATGGAGGCGGCGTGCCCGGGCACGGTCTCGTGCGCGGACATCGTCGCCTTCGCCGCCCGCGACGCATCCTACTTCCTC
AGCGGCGGCGGCATCAGCTTCGCCATGCCGGCGGGGCGCTACGACGGGACCGTCTCCCTCGCCAGCGAGACCCTCCCCAACCTGCCCCCGCCGTTCGCCGGCTTCGACCAGCTCGTCAAG
ATGTTCGACGACAAGGGGCTCGACGCCTTGGACATGATCACGCTCTCCGGCGCGCACAGCATCGGCCGCTCCCACTGCTCCTCCTTCACCAGGGACCGCCTGCCGCCCAGCAACACCACC
GACATGGACCCAGCGTTCGCCGCCACGCTGCAGGCTAGCTGCGCGTCGGCCAACGGCACCGACAACACGGTGATGCAGGACTTCGCCACCCCTGACGTCCTGGACAACCAGTACTACAAG
AACGTGCTGGCCCACAAGGTTCTCTTCACGTCGGACGCCGCGCTCACCACCAACTTCACGTCCAACAACCTGGTGCGCGCCTACGCGGACTTCGTGCCCTATCTGTGGCAGCAGAAGTTC
GCGAAAGCCATGGTGAAGATGGGCGGCGTCGAGATCAAAACCGCCGCCAATGGAGAGATCAGGAAGACATGCCGCAAGATCAACAGCAGGCCGTGA

Retrieve as FASTA