Entry information : ZmPrx31
Entry ID 727
Creation 2006-02-02 (Christophe Dunand)
Last sequence changes 2006-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Cyril Jourda
Last annotation changes 2011-10-13 (Cyril Jourda)
Peroxidase information: ZmPrx31
Name ZmPrx31
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor Glomus intraradices infection
Best BLASTp hits
Perox score E-value ZmPrx31
start..stop
S start..stop
SbPrx07 603 0 2..340 1..338
SiPrx147 514 0 27..341 25..342
SiPrx149 508 0 1..340 1..342
OsPrx125 501 2e-180 34..340 32..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40563372..40563611 240 N° 2 40563049..40563246 198 N° 3 40562040..40562630 591  
complement(join(40562040..40562630,40563049..40563246,40563372..40563611))


exon

Literature and cross-references ZmPrx31
Literature Hainey,C.F. et al., unpublished
Protein ref. UniProtKB:   B4FKV6
DNA ref. GenBank:   AC208442 (105858..107426)
mRNA ref. GenBank:   BT037744
Cluster/Prediction ref. UniGene:   Zm.5170
Protein sequence: ZmPrx31
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (309)
PWM (Da):   %s   36063.8 (33075.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   5.32 (5.10) Peptide Signal:   %s   cut: 34 range:34-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMASSSPQRAAGAAVAGVLLVAAAALCSCGAMAQLTADYYDCTCPDAYNIVKQVLIEAHKSDVRIYASLTRLHFHDCFVQGCDGSVLLDAVPGVANSTEKLAPANNNSARGFPVVDKVKAALEDACPGVVSCADILALAAEISVELSGGPKWAVLLGRLDSKKADFKSAENLPSPFDNLTVLEQKFAAVGLHTVDLVALSGAHTFGRVQCQFVTGRLYNFSGTNRPDPTLNSGYRAFLAQRCPQNGSPSALNDLDPTTPNLFDNHYYTNLEVNRGFLGSDQELKSAPQAQGVTAPVVDQFATSQAAFFSSFAQSMINMGNIQPLTDPAKGEVRCDCRVANDD*

Retrieve as FASTA  
Remarks Complete Sequence from genomic (chromo 5, introns 1 and 2) and 101 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGCTTCCTCTAGTCCTCAGCGTGCAGCCGGCGCCGCCGTCGCCGGCGTGCTGCTGGTGGCGGCTGCCGCCCTGTGCTCGTGCGGCGCCATGGCGCAGCTGACCGCGGACTACTAC
GACTGCACATGCCCTGACGCCTACAACATCGTGAAGCAGGTCCTGATCGAGGCGCACAAGTCCGACGTGCGCATCTACGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GTACGGTACGGTACCATGGCCATGCCGCATGCACGCATCAGCAATCAGCTGGTGTATATATATATTAATTAATAACCTGTTGCCGCCGTGCCGCATATCTCTGCTGTATGCATGTCTTCA
ATTAGGGCTGCGATGGCTCGGTGCTCCTGGACGCCGTTCCGGGGGTGGCCAACTCCACTGAGAAGCTGGCGCCGGCCAACAACAACTCGGCGCGAGGGTTCCCGGTGGTGGACAAAGTGA
AGGCGGCGCTGGAGGACGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCAGAGATCTCGGTCGAACTG
GTACGTACGGACGGACGGAGTAATATATATACACGTA
TGTAAGGTCCTACGTACTGCACTATTATATTCATGAAGAGGCCGGGTGACGTAGTTTTCAACATAAGATCGTCGATCGTTGACGTTGATACATATATAATAAACACTTAAATGTGAACAA
GGTAAGATCGTCGATCGAATATATAGCACCTTCAGATATAAACGATTTCATATATATAATTGCTCAAACGAATATATCACACTGCTTGTCCACCTAGCTAATAAGCCATGCATATCATGC
CAAAATATATGCTACGACGACAAAAACACAGGGCCCCGCATACATGCGCCTAACTTGTTGGTGCACATGCAATGTATGGATCGAATCGATTATTGGTCTAATAATAATACAAATTACATG
GCGTGCACACATGCAATGCAGTCCGGAGGACCAAAGTGGGCAGTGCTTCTTGGGAGGCTAGACAGCAAGAAGGCCGACTTCAAGAGCGCGGAGAACCTGCCGTCGCCGTTCGACAACCTG
ACGGTGCTGGAGCAGAAGTTCGCGGCCGTGGGCCTCCACACCGTGGACCTGGTGGCCCTCTCGGGAGCTCACACGTTCGGGCGGGTCCAGTGCCAGTTCGTCACGGGGCGGCTGTACAAC
TTCAGCGGCACGAACCGGCCGGACCCCACGCTCAACTCCGGCTACCGGGCGTTCCTGGCCCAGAGGTGCCCCCAGAACGGCAGCCCCTCGGCCCTCAACGACCTGGACCCCACGACGCCG
AACCTGTTCGACAACCACTACTACACCAACCTGGAGGTGAACCGGGGCTTCCTCGGCTCGGACCAGGAGCTCAAGTCGGCGCCGCAGGCGCAGGGCGTCACCGCGCCCGTCGTCGACCAG
TTCGCCACCAGCCAGGCCGCCTTCTTCAGCAGCTTCGCGCAGTCCATGATCAACATGGGCAACATCCAGCCGCTCACCGACCCGGCCAAGGGAGAGGTCCGCTGCGACTGCCGGGTGGCT
AATGATGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGCTTCCTCTAGTCCTCAGCGTGCAGCCGGCGCCGCCGTCGCCGGCGTGCTGCTGGTGGCGGCTGCCGCCCTGTGCTCGTGCGGCGCCATGGCGCAGCTGACCGCGGACTACTAC
GACTGCACATGCCCTGACGCCTACAACATCGTGAAGCAGGTCCTGATCGAGGCGCACAAGTCCGACGTGCGCATCTACGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GGCTGCGATGGCTCGGTGCTCCTGGACGCCGTTCCGGGGGTGGCCAACTCCACTGAGAAGCTGGCGCCGGCCAACAACAACTCGGCGCGAGGGTTCCCGGTGGTGGACAAAGTGAAGGCG
GCGCTGGAGGACGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCAGAGATCTCGGTCGAACTG
TCCGGAGGACCAAAGTGGGCAGTGCTTCTTGGGAGGCTAGAC
AGCAAGAAGGCCGACTTCAAGAGCGCGGAGAACCTGCCGTCGCCGTTCGACAACCTGACGGTGCTGGAGCAGAAGTTCGCGGCCGTGGGCCTCCACACCGTGGACCTGGTGGCCCTCTCG
GGAGCTCACACGTTCGGGCGGGTCCAGTGCCAGTTCGTCACGGGGCGGCTGTACAACTTCAGCGGCACGAACCGGCCGGACCCCACGCTCAACTCCGGCTACCGGGCGTTCCTGGCCCAG
AGGTGCCCCCAGAACGGCAGCCCCTCGGCCCTCAACGACCTGGACCCCACGACGCCGAACCTGTTCGACAACCACTACTACACCAACCTGGAGGTGAACCGGGGCTTCCTCGGCTCGGAC
CAGGAGCTCAAGTCGGCGCCGCAGGCGCAGGGCGTCACCGCGCCCGTCGTCGACCAGTTCGCCACCAGCCAGGCCGCCTTCTTCAGCAGCTTCGCGCAGTCCATGATCAACATGGGCAAC
ATCCAGCCGCTCACCGACCCGGCCAAGGGAGAGGTCCGCTGCGACTGCCGGGTGGCTAATGATGATTAA

Retrieve as FASTA