Entry information : AclKat03 (ACLA_077960)
Entry ID 7290
Creation 2010-04-11 (Marcel Zamocky)
Last sequence changes 2010-04-11 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-06-22 (Christophe Dunand)
Peroxidase information: AclKat03 (ACLA_077960)
Name (synonym) AclKat03 (ACLA_077960)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus clavatus    [TaxId: 5057 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AclKat03
start..stop
S start..stop
PEchKat01 876 0 9..494 5..490
TstKat01 788 0 6..494 2..491
NcKat04 550 0 8..484 7..480
CnKat04_grubiiH99 544 0 3..482 1..485
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 164802..164844 43 N° 2 164621..164750 130 N° 3 164333..164567 235 N° 4 164178..164270 93
N° 5 163706..164125 420 N° 6 163564..163648 85 N° 7 163024..163502 479  
complement(join(163024..163502,163564..163648,163706..164125,164178..164270,1643 33..164567,164621..164750,164802..164844))


exon

Literature and cross-references AclKat03 (ACLA_077960)
Literature Fedorova N.D., Khaldi N., Joardar V.S., Maiti R., Amedeo P., Anderson M.J., Crabtree J., Silva J.C., Badger J.H., Albarraq A., Angiuoli S., Bussey H., Bowyer P., Cotty P.J., Dyer P.S., Egan A., Galens K., Fraser-Liggett C.M. , Haas B.J., Inman J.M., Kent R., Lemieux S., Malavazi I., Orvis J., Roemer T., Ronning C.M., Sundaram J.P., Sutton G., Turner G., Venter J.C., White O.R., Whitty B.R., Youngman P., Wolfe K.H., Goldman G.H., Wortman J.R., Jiang B., Denning D.W., Nierman W.C. (2008) Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus. PLoS Genet.4:E1000046-E1000046.
Protein ref. UniProtKB:   A1CLR9
DNA ref. GenBank:   DS027057.1 (164844..163024)
Protein sequence: AclKat03 (ACLA_077960)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   494
PWM (Da):   %s   55225.73  
PI (pH):   %s   7.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTITTTKPTFTLAEGQPIADPSVSTTLPTFGSGAITTLGDTLLLETLAHFNRERIPERVVHAKAAGAWGEFEVTNDISSLTAAKFLNGVGKKTPVLFRLSTTGGEKGSADTVRDVRGFSVKFFTEQGNHDIVGNHPVFFVRDPIRFPSLNRSHKRHPATNRPDWTMFWDFHVNQPESVHALMHLFGSRGIPSSIRRVTGFGVHTFKLVAADGSFNYCKFHFRPAQSIAHFTGKQATLMAGANADFHNQDLWDAISRGQYPVWKLYVQVMKPEQAETYGRALFDITKVWPHAEFPLIEVGQMTLNKNPENYFAEIEQAAFSPSNMVPGIAMTPDPMLQARMFAYPDAQRYRLGVNYTQLPPNRAICPVYAPFERDGMGTITRNYGGDPNYVRSTLSPGIPSQVVSDVRHTERIAHNAMLGQNEIRVDDEDFIQPRELWTRVFDETERRQWVANVSETLENVAAPLRDAVIEMFNKVDPQIGQMMAAKTQSSSRL

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Strain="NRRL 1". No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAATCACCACGACGAAGCCTACATTTACATTGGCCGAAGGTGCCATCACTCGCATTCCCCCGGCCATGCTCCCCCACTGACATCCAGCAGGCCAGCCCATTGCAGATCCCTCGGTC
AGTACGACACTGCCCACTTTCGGTAGCGGTGCCATCACAACCTTGGGCGACACACTGCTCCTGGAGACACTTGCGCATTTCAACCGTGAGCGGATCCCTGAACG
GTCAGGAGCAATTCCC
CCCCTCCGTTGGCCAACGTCGAGCTGACATTGATCAGGGTGGTCCATGCCAAGGCTGCCGGTGCTTGGGGTGAATTCGAGGTCACCAACGATATCTCGTCCCTCACGGCAGCCAAGTTCC
TCAACGGCGTCGGCAAGAAAACGCCCGTGCTATTCCGTCTGAGCACGACGGGCGGCGAAAAAGGCAGCGCAGACACCGTGCGAGATGTGCGAGGCTTTTCCGTCAAGTTCTTCACGGAGC
AGGGCAATCATGACATTGTCGGGAACCACATT
GTCAGTCTCCATTCCTTGTGTCCTTACTCTTTTTTTTTGGCCTCGCTTCTAATTATCTCCAGCCGGTGTTCTTTGTGCGCGACCCGAT
CAGATTCCCTTCCCTCAACCGCAGTCATAAAAGGCATCCGGCTACTAACCGTCCGGATTGGACAATG
GTGAGTGGCATTGATATCGCCTGTCCGTGCCAGAATTCTAACTGGTCTCAAGT
TCTGGGACTTTCATGTCAACCAGCCCGAGAGTGTCCACGCCTTGATGCACCTATTTGGCTCGCGCGGTATCCCCAGTTCCATCCGTCGGGTGACAGGGTTCGGTGTGCACACCTTCAAGC
TGGTGGCGGCTGATGGCAGCTTCAATTACTGCAAATTCCACTTCCGGCCGGCGCAGAGCATCGCCCACTTCACTGGAAAACAGGCTACCCTCATGGCCGGGGCCAATGCCGACTTCCACA
ACCAGGATCTGTGGGATGCCATCTCCCGGGGCCAATATCCGGTATGGAAGCTGTACGTACAGGTCATGAAGCCCGAGCAGGCCGAGACCTACGGCCGCGCTCTATTCGATATTACCAAAG
TCTGGCCCCATGCGGAGTTCCCCTTGATTGAGGTCGGACAAATGACTCTGAACAAGAAT
GTAAAGACCACGCTCGATGCAAAAGTGACGAGCGCATGCTAACGAAGCCCAACACAGCCGG
AGAATTACTTTGCTGAGATCGAGCAAGCGGCATTCTCACCGTCTAACATGGTCCCCGGGATCGCAATGACACCCGACCCTA
GTAAGTCGCCCTATAACCTCGGGGAAGCTGTGACAAGGC
ACTAAGTACCCTTGCCCCGTAGTGCTGCAAGCCCGCATGTTCGCCTATCCCGACGCGCAACGATACCGCCTCGGGGTGAACTACACCCAGCTCCCGCCCAACCGGGCCATCTGCCCCGTC
TACGCGCCCTTCGAGCGCGACGGCATGGGCACCATCACCCGGAACTACGGCGGCGATCCCAACTACGTGCGGAGTACCTTGAGCCCCGGCATCCCCAGTCAGGTGGTATCCGACGTGCGC
CACACCGAGCGCATCGCGCATAATGCGATGCTCGGCCAGAACGAGATCCGGGTGGATGACGAGGACTTTATCCAGCCGCGCGAACTGTGGACGAGGGTGTTTGACGAGACCGAGAGAAGG
CAGTGGGTGGCGAATGTGTCGGAGACGCTGGAGAATGTGGCTGCACCGCTGAGGGATGCTGTCATCGAGATGTTCAACAAGGTCGATCCGCAGATTGGTCAAATGATGGCGGCGAAGACT
CAGAGCAGCTCGCGCCTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAATCACCACGACGAAGCCTACATTTACATTGGCCGAAGGCCAGCCCATTGCAGATCCCTCGGTCAGTACGACACTGCCCACTTTCGGTAGCGGTGCCATCACAACCTTGGGCGAC
ACACTGCTCCTGGAGACACTTGCGCATTTCAACCGTGAGCGGATCCCTGAACG
GGTGGTCCATGCCAAGGCTGCCGGTGCTTGGGGTGAATTCGAGGTCACCAACGATATCTCGTCCCTC
ACGGCAGCCAAGTTCCTCAACGGCGTCGGCAAGAAAACGCCCGTGCTATTCCGTCTGAGCACGACGGGCGGCGAAAAAGGCAGCGCAGACACCGTGCGAGATGTGCGAGGCTTTTCCGTC
AAGTTCTTCACGGAGCAGGGCAATCATGACATTGTCGGGAACCACATT
CCGGTGTTCTTTGTGCGCGACCCGATCAGATTCCCTTCCCTCAACCGCAGTCATAAAAGGCATCCGGCTACT
AACCGTCCGGATTGGACAATG
TTCTGGGACTTTCATGTCAACCAGCCCGAGAGTGTCCACGCCTTGATGCACCTATTTGGCTCGCGCGGTATCCCCAGTTCCATCCGTCGGGTGACAGGG
TTCGGTGTGCACACCTTCAAGCTGGTGGCGGCTGATGGCAGCTTCAATTACTGCAAATTCCACTTCCGGCCGGCGCAGAGCATCGCCCACTTCACTGGAAAACAGGCTACCCTCATGGCC
GGGGCCAATGCCGACTTCCACAACCAGGATCTGTGGGATGCCATCTCCCGGGGCCAATATCCGGTATGGAAGCTGTACGTACAGGTCATGAAGCCCGAGCAGGCCGAGACCTACGGCCGC
GCTCTATTCGATATTACCAAAGTCTGGCCCCATGCGGAGTTCCCCTTGATTGAGGTCGGACAAATGACTCTGAACAAGAAT
CCGGAGAATTACTTTGCTGAGATCGAGCAAGCGGCATTC
TCACCGTCTAACATGGTCCCCGGGATCGCAATGACACCCGACCCTA
TGCTGCAAGCCCGCATGTTCGCCTATCCCGACGCGCAACGATACCGCCTCGGGGTGAACTACACCCAGCTCCCG
CCCAACCGGGCCATCTGCCCCGTCTACGCGCCCTTCGAGCGCGACGGCATGGGCACCATCACCCGGAACTACGGCGGCGATCCCAACTACGTGCGGAGTACCTTGAGCCCCGGCATCCCC
AGTCAGGTGGTATCCGACGTGCGCCACACCGAGCGCATCGCGCATAATGCGATGCTCGGCCAGAACGAGATCCGGGTGGATGACGAGGACTTTATCCAGCCGCGCGAACTGTGGACGAGG
GTGTTTGACGAGACCGAGAGAAGGCAGTGGGTGGCGAATGTGTCGGAGACGCTGGAGAATGTGGCTGCACCGCTGAGGGATGCTGTCATCGAGATGTTCAACAAGGTCGATCCGCAGATT
GGTCAAATGATGGCGGCGAAGACTCAGAGCAGCTCGCGCCTTTAG

Retrieve as FASTA