Entry information : ZmPrx34 (Peroxidase1 / GRMZM2G088765 [6a])
Entry ID 730
Creation 2009-01-13 (Christophe Dunand)
Last sequence changes 2009-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-07-01 (Christophe Dunand)
Peroxidase information: ZmPrx34 (Peroxidase1 / GRMZM2G088765 [6a])
Name (synonym) ZmPrx34 (Peroxidase1 / GRMZM2G088765 [6a])
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation Cell wall
Tissue type Roots
Inducer Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx34
start..stop
S start..stop
SiPrx152 568 0 26..337 25..336
SiPrx149 545 0 1..337 1..342
OsPrx125 532 0 33..337 32..336
SiPrx147 512 0 4..337 3..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 110491733..110491969 237 N° 2 110492095..110492286 192 N° 3 110492904..110493066 163 N° 4 110493154..110493575 422
join(110491733..110491969,110492095..110492286,110492904..110493066,110493154..1 10493575)


exon

Literature and cross-references ZmPrx34 (Peroxidase1 / GRMZM2G088765 [6a])
Literature Wang,H. and Bohnert,H.J., unpublished
Protein ref. UniProtKB:   B6T7B1 [Mismatch]
DNA ref. GenBank:   AC210030.4 (95440..97286)
mRNA ref. GenBank:   EU958738
Protein sequence: ZmPrx34 (Peroxidase1 / GRMZM2G088765 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (305)
PWM (Da):   %s   35841.42 (32820.0) Transmb domain:   %s   o10-32i
PI (pH):   %s   4.26 (4.21) Peptide Signal:   %s   cut: 33 range:33-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSSSSSPSATAAAVVLAVALMTTTCFHGATAQLCEDYYDSTCPDAYDIVKQVLVDAVQSDTRIFASLIRLHFHDCFVQGCDASLLLDSVPGMPSEKTSAPNNGSARGFGVVDAAKAALESACPGVVSCADILAIAAEISVELSGGPSWGVLLGRLDSKTSDFNGSLDLPEPTDNLTILQQKFSNLSLNDVDLVALSGGHTFGRVQCKFITDRLYNFSGTNMPDPTLDASYRAFLTQRCPRNGDPTALNDLDPTTPDTFDNNYYTNIEVNRGILNSDQELKSSPLAQGTTAPIVDQFAASQDDFFASFAQSMINMGNIKPLTDPSRGEVRTNCRRVN

Retrieve as FASTA  
Remarks Complete Sequence from genomic (chromo 1, 3 introns) and 29 ESTs. GeneChip® Maize Genome Array ID: Zm.3573.1.A1_at. QTL lignin
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCTCGTCGTCGTCTCCTTCCGCCACCGCCGCCGCCGTGGTCCTGGCGGTGGCCCTGATGACGACGACGTGCTTCCATGGCGCGACGGCGCAGCTGTGCGAGGACTACTATGAC
AGCACCTGCCCGGACGCCTACGACATCGTGAAGCAGGTGCTCGTCGACGCAGTGCAGTCGGACACCCGCATCTTCGCCAGCCTCATCCGCCTGCACTTCCACGACTGCTTCGTCCAG
GTG
TGTGTGTGCATGTTCTCCATAACTCAGATCGATTAGATTCGTCAGAGTTGATTCGTGAAAGCTCCACCATACAAATTAACCTATAGCTAACCTTACCAACATACCGGCCATATATACTGT
AGGGCTGCGACGCCTCGCTTCTGCTGGACAGCGTCCCGGGGATGCCGTCGGAGAAGACGTCGGCGCCCAACAACGGCTCAGCGCGCGGGTTCGGGGTGGTGGACGCCGCCAAGGCTGCCC
TGGAGAGCGCCTGCCCTGGTGTTGTCTCCTGCGCTGACATCCTCGCCATCGCCGCAGAGATCTCAGTCGAGCTG
GTACCGTACCTAGCTATTCCTGTTATATATATATATATATATATAT
ATATATATATATATATATACGTTCACGTTCCTGCATGCATGCCTAGCTAGCTACTTGAATTACACACTACATGTTTGTGATCTCGTTCAACTATTATTTAATTGCATAAATGCATGTTTA
ATCAAGATTATAAAAAAGAAAAATGTTTATTGTAATAAGTACCATTACATATTAATTATGTTCTTACATGTAATATATATATTTGCATCGAAACACACCTCTATTATTGATACTCCACTA
GTATAGAAGTCCTAGTCTGAGTCTGATTAAGAGCTTATTATATTGATCAAAGGACAGAACATGAGCCGATTATTTAGAATACAATATTATATATATGTGGATCAAAGAACATGTGAGAAA
TGTTTCGACGACACCCGATCATCAGGCAGAAACAAACAAATAAATAGGAATCTGATGCAACATGGGGCACGTAGATAGGAGTCACAAGATGGCAAAACGACGACGCTGCATGCAGTGGAC
GCCAATAAATGCTAATGTTATTCATAATTAATCCTAAATATACGTACTAATTACAGTACATGGCACGGCCATGCATACGCATCACATGCAGTCGGGAGGCCCCAGCTGGGGTGTGCTTCT
GGGCAGGCTGGACAGCAAGACCTCCGACTTCAACGGATCCCTGGACCTCCCAGAGCCCACCGACAACCTCACCATACTTCAGCAGAAGTTCAGCAACCTCAGTCTCAACGATGTCGACCT
GGTCGCCCTTTCAG
GTACTACATGCACACATTTATCACCACATGACACTAGCTAATTACTGTATTTTCACTAACACCATAATGCAATATTGCAATGCGAAGGGGGGCACACGTTCGGCCG
GGTCCAATGCAAGTTCATCACGGACCGGCTCTACAACTTCAGCGGGACGAACATGCCCGACCCGACGCTGGACGCCTCCTACCGAGCCTTCCTGACACAGAGATGCCCCAGGAACGGCGA
CCCCACAGCCCTGAACGACCTGGACCCGACGACCCCGGACACCTTCGACAACAACTACTACACCAACATCGAGGTGAACCGAGGCATCCTCAACTCCGACCAGGAGCTCAAGTCGTCGCC
CCTAGCGCAGGGCACCACGGCGCCCATCGTCGACCAGTTCGCGGCCAGCCAAGACGACTTCTTCGCGAGCTTCGCGCAGTCCATGATCAACATGGGGAACATCAAGCCGCTCACGGACCC
GTCCAGAGGAGAAGTCCGCACCAACTGCAGAAGGGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCTCGTCGTCGTCTCCTTCCGCCACCGCCGCCGCCGTGGTCCTGGCGGTGGCCCTGATGACGACGACGTGCTTCCATGGCGCGACGGCGCAGCTGTGCGAGGACTACTATGAC
AGCACCTGCCCGGACGCCTACGACATCGTGAAGCAGGTGCTCGTCGACGCAGTGCAGTCGGACACCCGCATCTTCGCCAGCCTCATCCGCCTGCACTTCCACGACTGCTTCGTCCAG
GGC
TGCGACGCCTCGCTTCTGCTGGACAGCGTCCCGGGGATGCCGTCGGAGAAGACGTCGGCGCCCAACAACGGCTCAGCGCGCGGGTTCGGGGTGGTGGACGCCGCCAAGGCTGCCCTGGAG
AGCGCCTGCCCTGGTGTTGTCTCCTGCGCTGACATCCTCGCCATCGCCGCAGAGATCTCAGTCGAGCTG
TCGGGAGGCCCCAGCTGGGGTGTGCTTCTGGGCAGGCTGGACAGCAAGACC
TCCGACTTCAACGGATCCCTGGACCTCCCAGAGCCCACCGACAACCTCACCATACTTCAGCAGAAGTTCAGCAACCTCAGTCTCAACGATGTCGACCTGGTCGCCCTTTCAG
GGGGGCAC
ACGTTCGGCCGGGTCCAATGCAAGTTCATCACGGACCGGCTCTACAACTTCAGCGGGACGAACATGCCCGACCCGACGCTGGACGCCTCCTACCGAGCCTTCCTGACACAGAGATGCCCC
AGGAACGGCGACCCCACAGCCCTGAACGACCTGGACCCGACGACCCCGGACACCTTCGACAACAACTACTACACCAACATCGAGGTGAACCGAGGCATCCTCAACTCCGACCAGGAGCTC
AAGTCGTCGCCCCTAGCGCAGGGCACCACGGCGCCCATCGTCGACCAGTTCGCGGCCAGCCAAGACGACTTCTTCGCGAGCTTCGCGCAGTCCATGATCAACATGGGGAACATCAAGCCG
CTCACGGACCCGTCCAGAGGAGAAGTCCGCACCAACTGCAGAAGGGTCAACTGA

Retrieve as FASTA