Entry information : PEchCcP01
Entry ID 7313
Creation 2010-04-16 (Marcel Zamocky)
Last sequence changes 2011-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: PEchCcP01
Name PEchCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Penicillium
Organism Penicillium chrysogenum    [TaxId: 5076 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PEchCcP01
start..stop
S start..stop
AnCcP01 525 0 2..301 3..302
AcarCcP01 525 0 2..301 3..302
AniCcP01 520 0 5..301 6..302
AwenCcP01 518 0 2..304 3..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2373191..2373297 107 N° 2 2372277..2373084 808  
complement(join(2372277..2373084,2373191..2373297))


exon

Literature and cross-references PEchCcP01
Literature van den Berg M.A., Albang R., Albermann K., Badger J.H., Daran J.-M. et al.(2008) Genome sequencing and analysis of the filamentous fungus Penicillium chrysogenum. Nat. Biotechnol. 26 (10), 1161-1168.
Protein ref. UniProtKB:   B6HPK0
DNA ref. JGI genome:   scaffold_5 (2373297..2372277)
Cluster/Prediction ref. JGI gene:   37932
Protein sequence: PEchCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   304
PWM (Da):   %s   33335.41  
PI (pH):   %s   5.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTHDYDAVRKDIAAILQKPGYDDGSAGPVFVRLAWHSSGTYDAETDTGGSNGAGMRYEAEGGDPANAGLQHGRAFLEPIKEKHPWITYSDLWTLAGVVAIKEMGGPDIPWQGGRTDLIGDTKVPPRGRLPDGAQGADHLRFIFYRMGFNDQEIVALTGGHNLGRCHGDRSGFEGPWVTNPTRFSNSFFKLLLQLDWKPRKMASGMTQFVYEDPDAEEDEEPLMMLPTDMSLLTDPAFSPWVKRYAEDKELFFDHFSKVFAKLIELGIRRDAQGAVTNTDGTLGGYVSAPKKSNTATGPPRARL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Strain="ATCC 28089/DSM 1075/Wisconsin 54-1255".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACTCACGACTATGACGCCGTCCGCAAGGACATCGCCGCTATCCTGCAGAAGCCCGGTTATGACGATGGCAGCGCAGGACCCGTATTCGTGCGACTAGCATGGTAAGTAAATGTG
ATCCTCGAAGCCTTGTTCTTCGGTCGGGGACCCTCGGACCAACGGGGCGATAAGCCTTCCTCAACGCAATATCACTGACAATATCTCAAACAGGCACTCGTCTGGCACGTACGACGCCGA
AACTGACACCGGTGGTTCCAACGGAGCCGGCATGCGGTACGAAGCAGAGGGTGGCGATCCCGCCAACGCGGGTCTGCAGCACGGACGGGCATTCCTGGAGCCGATTAAAGAGAAGCACCC
CTGGATCACGTACTCGGATCTGTGGACTCTGGCCGGCGTAGTTGCGATCAAGGAGATGGGCGGACCCGATATCCCCTGGCAAGGCGGACGCACAGATCTGATAGGCGACACCAAGGTGCC
GCCACGGGGACGACTGCCAGACGGAGCCCAGGGCGCCGACCACCTGCGGTTCATCTTCTATCGCATGGGTTTCAACGACCAGGAGATCGTCGCGCTGACGGGCGGACACAACCTGGGCCG
GTGCCACGGCGACCGCAGTGGATTCGAGGGTCCGTGGGTGACGAACCCGACGCGGTTCTCGAACTCGTTCTTCAAATTGCTGCTTCAGCTTGACTGGAAGCCTCGCAAAATGGCGTCGGG
TATGACGCAGTTTGTGTATGAGGATCCCGATGCCGAGGAGGACGAGGAGCCATTAATGATGCTGCCGACTGATATGTCGCTTTTGACGGACCCGGCATTTTCCCCGTGGGTTAAGCGATA
TGCCGAGGATAAGGAGTTGTTCTTCGATCACTTCTCCAAGGTGTTTGCCAAACTGATTGAACTTGGCATCCGGCGCGATGCTCAGGGTGCAGTGACCAACACTGACGGCACCCTGGGTGG
GTATGTTTCGGCACCGAAGAAGAGCAACACTGCTACAGGCCCGCCCAGAGCGCGTCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACTCACGACTATGACGCCGTCCGCAAGGACATCGCCGCTATCCTGCAGAAGCCCGGTTATGACGATGGCAGCGCAGGACCCGTATTCGTGCGACTAGCATGGCACTCGTCTGGC
ACGTACGACGCCGAAACTGACACCGGTGGTTCCAACGGAGCCGGCATGCGGTACGAAGCAGAGGGTGGCGATCCCGCCAACGCGGGTCTGCAGCACGGACGGGCATTCCTGGAGCCGATT
AAAGAGAAGCACCCCTGGATCACGTACTCGGATCTGTGGACTCTGGCCGGCGTAGTTGCGATCAAGGAGATGGGCGGACCCGATATCCCCTGGCAAGGCGGACGCACAGATCTGATAGGC
GACACCAAGGTGCCGCCACGGGGACGACTGCCAGACGGAGCCCAGGGCGCCGACCACCTGCGGTTCATCTTCTATCGCATGGGTTTCAACGACCAGGAGATCGTCGCGCTGACGGGCGGA
CACAACCTGGGCCGGTGCCACGGCGACCGCAGTGGATTCGAGGGTCCGTGGGTGACGAACCCGACGCGGTTCTCGAACTCGTTCTTCAAATTGCTGCTTCAGCTTGACTGGAAGCCTCGC
AAAATGGCGTCGGGTATGACGCAGTTTGTGTATGAGGATCCCGATGCCGAGGAGGACGAGGAGCCATTAATGATGCTGCCGACTGATATGTCGCTTTTGACGGACCCGGCATTTTCCCCG
TGGGTTAAGCGATATGCCGAGGATAAGGAGTTGTTCTTCGATCACTTCTCCAAGGTGTTTGCCAAACTGATTGAACTTGGCATCCGGCGCGATGCTCAGGGTGCAGTGACCAACACTGAC
GGCACCCTGGGTGGGTATGTTTCGGCACCGAAGAAGAGCAACACTGCTACAGGCCCGCCCAGAGCGCGTCTGTAG

Retrieve as FASTA