Entry information : HaPrx09 (HanXRQChr10g0315521)
Entry ID 7362
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPrx09 (HanXRQChr10g0315521)
Name (synonym) HaPrx09 (HanXRQChr10g0315521)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPrx09
start..stop
S start..stop
HaPrx09_ANN1312 622 0 1..307 1..307
LsePrx19 559 0 1..324 2..323
CsPrx29 511 0 13..324 4..314
CclPrx45 511 0 13..324 12..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 232174711..232174920 210 N° 2 232173918..232174097 180 N° 3 232173425..232173587 163 N° 4 232172712..232173133 422
complement(join(232172712..232173133,232173425..232173587,232173918..232174097,2 32174711..232174920))


exon

Literature and cross-references HaPrx09 (HanXRQChr10g0315521)
DNA ref. HanXRQ genome:   HanXRQChr10 (232174920..232172712)
EST ref. GenBank:   BQ972322.1 [3' end]
Cluster/Prediction ref. HanXRQ:   HanXRQChr10g0315521
Protein sequence: HaPrx09 (HanXRQChr10g0315521)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (303)
PWM (Da):   %s   34538.54 (32796.6)  
PI (pH):   %s   9.59 (7.31) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEINVLIVISLSLMLIPFAKPQGGLKTGFYSSTCPKAEAIVRSTVEAHFKDDPTVAAGLLRLHFHDCFVEGCDGSILIKGKSAEITALANLGLRGFEVIDDAKTQLEALCPGVVSCADILALAARDSVDLSDGPNWPVPTGRRDGRVSLASKVSSLPSPLDSVDTQRSKFAAKGLDDKDLVTLSGAHTIGQTDCRFFRYRLYNFTTTGNSDPSLSQSALAQFQSLCPKNTDGTERVALDKDSPTKFDVNYFKNVRDGNGVLESDQRLWGDPTTQKIVRNYAGTFRGLLGLRFDFEFKNSMIQMSSIEVKTGTQGEIRKVCSKIN

Retrieve as FASTA  
Remarks Partial sequence from genomic and 4 ESTs (BQ969053.1, BQ916832.1, BQ967363.1). Cultivar="RHA801".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATTAATGTCCTCATTGTCATTAGTTTGAGTTTAATGTTAATCCCTTTTGCTAAACCTCAAGGAGGATTAAAAACCGGGTTTTACTCGTCTACATGTCCCAAAGCTGAAGCGATA
GTGAGATCAACGGTTGAGGCACACTTCAAGGATGATCCTACTGTTGCTGCTGGACTTCTCAGGCTTCATTTTCATGATTGCTTTGTTGAG
GTACTTGTTTACTTAAAAGGGTGTTTTTGG
AATGAAAAAAAGTTTTAAACTTTATTAATAGGGTTGTAATCAAGCCGAGTTGTGCTGAACCAGGTTGAGATCAAGCTCGAGCTCGAACTTAAACGAGTCATCTCAACTTGGCTCATTTAT
TTTATGGAGCTGAAAAGTTGAGCTTGACTCGTAAAATGTTCGAGCCAGCTCGAGCCAAATCAAGTTGGCTCGTTAATTTGTTTTACTTTTTTCTTTGATTGTTTTTGGAAATATTGATAA
CATAAGAAACAAAAGATAATAAAAAATACACATATATGGTATATCTATATGTGTTATTTTTATTTTTCTAATATTTTAAATACGAAAGACATTAAAAGTATTATATGTATATGTTATTAA
TCAATTAAACTTAAAATGTTAACACTTCAACCCCTCTCACATATTTTTTATTTTAATACATTTAAAATTAAAATTCATCTATATTAGTAGAATAATTTGAGCCGGCTCGTGAGCTCACGA
GCCAAGTCGGCTCAGTATTTTTCGAGGTTTTTTTTTTAGCTAGCTGCGAGCTTTTTGAACACCCCTGTTTATTAATTGTTTATTAATGGATTTTCCTTTTTAGGGCTGTGATGGGTCAAT
CTTGATCAAGGGAAAATCTGCTGAGATTACTGCACTGGCTAATCTTGGATTAAGAGGATTTGAAGTCATTGATGATGCTAAGACACAACTAGAAGCTTTGTGCCCTGGTGTTGTTTCTTG
TGCTGATATTCTTGCATTGGCTGCGCGCGATTCGGTTGATTTG
GTAATCTTTTTGTCCTTGATTGCTAAATATATATAGTGAAAGTTTTAAATACAAACGAGTTTTAACGTGCGACAGTA
CGAAGTGACCAAAATAACGTGCGTAATTATGTATAAAGCATGCGTTATTAGGGTGAGTTTTAACCATGCGTAATATTCATGTTTGATGGCATGCAAGATTTGAATTTTATAACATGCGTA
ATTATATATATGATGCGTAATTACGAAATGTGGACTTCGTATTCTTCGCACGTTAAGGGGCTATTGTACGATAACCCACCCCTATATATAATCCTGATTATGATTATCTTATGTATTTTA
TGTCACGTTTAAGAGTGACGGCCCAAATTGGCCGGTACCAACGGGGAGACGAGATGGCAGAGTATCATTGGCTTCTAAAGTATCAAGTTTACCATCACCGTTAGATTCGGTTGACACCCA
AAGAAGCAAGTTTGCTGCTAAAGGCCTTGACGATAAAGATTTAGTGACACTATCTG
GTACGTTACATCATATCCTCACAAACATGACACCTTAGATGAATCTTACATCATTATGTTTTGG
TCCTTAGTAAAGATATCGGGCCACAAAATATCATTTCTTAAATATCAACAACGCGTTTTTAGGCACACCAACTGTAAATAAGAAAAAACTTTACGGGTAAGCGTGCACAAAACAGACAAT
ATTGGTTGATATGAGTGGTCAGATGTTACATAAACCTACCATATATAATCTTACATTTGATTATTGTAACTTCACTATGAAAAAGCATATATAATTTTGTGATGTAGGTGCACATACAAT
AGGCCAAACAGATTGTAGATTCTTTCGATACCGTCTATACAACTTCACAACAACAGGGAATTCAGACCCGAGCTTGAGCCAGTCGGCTCTAGCCCAGTTCCAGAGCTTGTGTCCAAAGAA
CACCGATGGCACAGAACGAGTGGCATTGGATAAAGACAGCCCAACAAAGTTTGATGTTAACTATTTCAAGAACGTGCGCGATGGAAATGGTGTTTTGGAGTCGGATCAGAGATTATGGGG
CGACCCGACGACTCAAAAGATTGTGAGAAACTATGCAGGAACATTTAGAGGGTTGTTGGGATTGAGATTCGATTTCGAGTTTAAAAATTCTATGATCCAAATGAGTAGCATTGAAGTAAA
AACTGGTACACAAGGGGAAATTAGAAAGGTTTGTTCCAAGATCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATTAATGTCCTCATTGTCATTAGTTTGAGTTTAATGTTAATCCCTTTTGCTAAACCTCAAGGAGGATTAAAAACCGGGTTTTACTCGTCTACATGTCCCAAAGCTGAAGCGATA
GTGAGATCAACGGTTGAGGCACACTTCAAGGATGATCCTACTGTTGCTGCTGGACTTCTCAGGCTTCATTTTCATGATTGCTTTGTTGAG
GGCTGTGATGGGTCAATCTTGATCAAGGGA
AAATCTGCTGAGATTACTGCACTGGCTAATCTTGGATTAAGAGGATTTGAAGTCATTGATGATGCTAAGACACAACTAGAAGCTTTGTGCCCTGGTGTTGTTTCTTGTGCTGATATTCTT
GCATTGGCTGCGCGCGATTCGGTTGATTTG
AGTGACGGCCCAAATTGGCCGGTACCAACGGGGAGACGAGATGGCAGAGTATCATTGGCTTCTAAAGTATCAAGTTTACCATCACCGTTA
GATTCGGTTGACACCCAAAGAAGCAAGTTTGCTGCTAAAGGCCTTGACGATAAAGATTTAGTGACACTATCTG
GTGCACATACAATAGGCCAAACAGATTGTAGATTCTTTCGATACCGT
CTATACAACTTCACAACAACAGGGAATTCAGACCCGAGCTTGAGCCAGTCGGCTCTAGCCCAGTTCCAGAGCTTGTGTCCAAAGAACACCGATGGCACAGAACGAGTGGCATTGGATAAA
GACAGCCCAACAAAGTTTGATGTTAACTATTTCAAGAACGTGCGCGATGGAAATGGTGTTTTGGAGTCGGATCAGAGATTATGGGGCGACCCGACGACTCAAAAGATTGTGAGAAACTAT
GCAGGAACATTTAGAGGGTTGTTGGGATTGAGATTCGATTTCGAGTTTAAAAATTCTATGATCCAAATGAGTAGCATTGAAGTAAAAACTGGTACACAAGGGGAAATTAGAAAGGTTTGT
TCCAAGATCAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAGAAACTT AAACCGCGTT AAGTTGGAGC AAAAGCGCCA CCATTACACT ATCGAAAAAG ACACCAAATC TGTTGTATCA ACTCCTTGTC TTTTCCTCTT TATTGGTTCG ATGAGTCAGT  CGATCGATCG AGCTCCACTA ATATTAATGG GCTTGAACTA GTCAGCTACT AGCACTATAT ATAGAGCTTG TTAGATAGAA CATTAGAACC ATACTGTATA CAAAAATGGA GATTAATGTC  CTCATTGTCA TTAGTTTGAG TTTAATGTTA ATCCCTTTTG CTAAACCTCA AGGAGGATTA AAAACCGGGT TTTACTCGTC TACATGTCCC AAAGCTGAAG CGATAGTGAG ATCAACGGTT  GAGGCACACT TCAAGGATGA TCCTACTGTT GCTGCTGGAC TTCTCAGGCT TCATTTTCAT GATTGCTTTG TTGAGGGCTG TGATGGGTCA ATCTTGATCA AGGGAAAATC TGCTGAGATT  ACTGCACTGG CTAATCTTGG ATTAAGAGGA TTTGAAGTCA TTGATGATGC TAAGACACAA CTAGAAGCTT TGTGCCCTGG TGTTGTTTCT TGTGCTGATA TTCTTGCATT GGCTGCGCGC  GATTCGGTTG ATTTGAGTGA CGGCCCAAAT TGGCCGGTAC CAACGGGGAG ACGAGATGGC AGAGTATCAT TGGCTTCTAA AGTATCAAGT TTACCATCAC CGTTAGATTC GGTTGACACC  CAAAGAAGCA AGTTTGCTGC TAAAGGCCTT GACGATAAAG ATTTAGTGAC ACTATCTGGT GCACATACAA TAGGCCAAAC AGATTGTAGA TTCTTTCGAT ACCGTCTATA CAACTTCACA  ACAACAGGGA ATTCAGACCC GAGCTTGAGC CAGTCGGCTC TAGCCCAGTT CCAGAGCTTG TGTCCAAAGA ACACCGATGG CACAGAACGA GTGGCATTGG ATAAAGACAG CCCAACAAAG  TTTGATGTTA ACTATTTCAA GAACGTGCGC GATGGAAATG GTGTTTTGGA GTCGGATCAG AGATTATGGG GCGACCCGAC GACTCAAAAG ATTGTGAGAA ACTATGCAGG AACATTTAGA  GGGTTGTTGG GATTGAGATT CGATTTCGAG TTTAAAAATT CTATGATCCA AATGAGTAGC ATTGAAGTAA AAACTGGTAC ACAAGGGGAA ATTAGAAAGG TTTGTTCCAA GATCAACTAA  ATATTGTGTA AAGATTAAAG AACAGGTTGT TTATGGTTAA CTGTTTTAAC GGTATTGTAT CTTGTGTATT GTGCAATAAA AGTGATTAGT TTGGACAGTG TATCTTTTGT TTTGATGAAG 
TTTTTGTATG GTTGTATTGA AAACTTTGTT GAAAATGTAC ATAAATCCC 

Retrieve as FASTA