Entry information : Sm1CysPrx02-2_8 (Sm1CysPrx02b_8)
Entry ID 7377
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-01 (Christophe Dunand)
Peroxidase information: Sm1CysPrx02-2_8 (Sm1CysPrx02b_8)
Name (synonym) Sm1CysPrx02-2_8 (Sm1CysPrx02b_8)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sm1CysPrx02-2_8
start..stop
S start..stop
Sm1CysPrx02-1_0 458 2e-167 1..220 1..220
Egu1CysPrx03 322 2e-113 1..220 1..220
Egr1CysPrx03 322 2e-113 1..220 1..220
Lu1CysPrx219 321 4e-113 1..220 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 886561..886678 118 N° 2 886351..886499 149 N° 3 886120..886266 147 N° 4 885801..886049 249
complement(join(885801..886049,886120..886266,886351..886499,886561..886678))


exon

Literature and cross-references Sm1CysPrx02-2_8 (Sm1CysPrx02b_8)
DNA ref. JGI genome:   scaffold_8 (886678..885801)
EST ref. GenBank:   FE476995.1
Cluster/Prediction ref. UniGene:   Smo.4755
Protein sequence: Sm1CysPrx02-2_8 (Sm1CysPrx02b_8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   24275.24  
PI (pH):   %s   6.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGISIGDEIPDIHADSTHGPINLHEFCKNNWTLVFSHPADFTPVCTTELGSVAKYQPEIEKRGAKLLGLSCDTVEEHKAWTKDVEAYTGACVKYPIMADPTREISRKLNMLDPDEKDSSGQPVASRALHIVGPDCRIRVSFMYPASVGRNFDEVIRVLDALQLSSKHKIACPVNWKPGDHVVISPSVSDEEAKKMFPQGYKTVDLPSGKKYMRLVKVD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and ESTs. Unigene compiles ESTs from both haplotypes. Strain="Plant Delights".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCATTTCGATTGGAGATGAGATTCCGGACATCCACGCCGACTCTACTCACGGCCCCATAAATCTTCACGAGTTTTGCAAGAACAACTGGACGCTCGTCTTCTCTCATCCCGGT
AAGAACGTTCTTGTTCCAAGAAGGCAAAAAAAGAGGCATTTTGCTTCCCCTTCTTTCAGCTGACTTCACTCCGGTTTGCACCACCGAGCTCGGGAGCGTCGCCAAGTACCAGCCCGAGAT
CGAGAAGCGAGGAGCCAAGCTGCTGGGCCTCTCCTGTGATACCGTCGAGGAGCACAAGGCCTGGACCAAGGATGTCGAAGCTTACACG
GTGCGCGTCTTCCATCTCTCGCTGCAGTGCAG
TGATCTTATACCTATACCTTCCATCTGTTTTCTCTGTGAATCCGGGAACTAGACTGGAGCATGCGTCAAGTACCCCATCATGGCCGATCCGACCCGGGAGATCTCCAGGAAGCTCAATAT
GCTCGATCCGGACGAGAAAGATTCGTCGGGGCAGCCGGTTGCTTCGAGGGCTCTTCACATCGTCGGTCCTGACTGTCGG
GTAGGATCCTTTGCATGCTTTCGCTTCTCATCCTCTTCGTT
TCATGCGTTGTCTCTTCTCTCTCTTGCAGATCAGGGTGAGCTTCATGTATCCTGCCTCGGTCGGACGCAACTTTGACGAGGTGATCCGCGTGCTGGATGCGCTGCAGCTCTCCTCCAAGC
ACAAGATTGCCTGCCCCGTTAACTGGAAGCCCGGCGATCACGTCGTCATCTCCCCCTCGGTATCCGACGAGGAGGCCAAGAAGATGTTCCCCCAGGGATACAAGACGGTCGATCTTCCTT
CCGGGAAGAAGTACATGCGTCTTGTCAAGGTGGATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCATTTCGATTGGAGATGAGATTCCGGACATCCACGCCGACTCTACTCACGGCCCCATAAATCTTCACGAGTTTTGCAAGAACAACTGGACGCTCGTCTTCTCTCATCCCGCT
GACTTCACTCCGGTTTGCACCACCGAGCTCGGGAGCGTCGCCAAGTACCAGCCCGAGATCGAGAAGCGAGGAGCCAAGCTGCTGGGCCTCTCCTGTGATACCGTCGAGGAGCACAAGGCC
TGGACCAAGGATGTCGAAGCTTACACG
ACTGGAGCATGCGTCAAGTACCCCATCATGGCCGATCCGACCCGGGAGATCTCCAGGAAGCTCAATATGCTCGATCCGGACGAGAAAGATTCG
TCGGGGCAGCCGGTTGCTTCGAGGGCTCTTCACATCGTCGGTCCTGACTGTCGG
ATCAGGGTGAGCTTCATGTATCCTGCCTCGGTCGGACGCAACTTTGACGAGGTGATCCGCGTGCTG
GATGCGCTGCAGCTCTCCTCCAAGCACAAGATTGCCTGCCCCGTTAACTGGAAGCCCGGCGATCACGTCGTCATCTCCCCCTCGGTATCCGACGAGGAGGCCAAGAAGATGTTCCCCCAG
GGATACAAGACGGTCGATCTTCCTTCCGGGAAGAAGTACATGCGTCTTGTCAAGGTGGATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTTGTTTTG TTGGCTTGAT AATCGCGAGA GAGCAGCATA AGCTAGAGAC AAGATGCCAG GCATTTCGAT TGGAGATGAG ATTCCGGACA TCCACGCCGA CTCTACTCAC GGCCCCATAA  ATCTTCACGA GTTTTGCAAG AACAACTGGA CGCTCGTCTT CTCTCATCCC GCTGACTTCA CTCCGGTTTG CACCACCGAG CTCGGGAGCG TCGCCAAGTA CCAGCCCGAG ATCGAGAAGC  GAGGAGCCAA GCTGCTGGGC CTCTCCTGTG ATACCGTCGA GGAGCACAAG GCCTGGACCA AGGATGTCGA AGCTTACACG ACTGGAGCAT GCGTCAAGTA CCCCATCATG GCCGATCCGA  CCCGGGAGAT CTCCAGGAAG CTCAATATGC TCGATCCGGA CGAGAAAGAT TCGTCGGGGC AGCCGGTTGC TTCGAGGGCT CTTCACATCG TCGGTCCTGA CTGTCGGATC AGGGTGAGCT  TCATGTATCC TGCCTCGGTC GGACGCAACT TTGACGAGGT GATCCGCGTG CTGGATGCGC TGCAGCTCTC CTCCAAGCAC AAGATTGCCT GCCCCGTTAA CTGGAAGCCC GGCGATCACG  TCGTCATCTC CCCCTCGGTA TCCGACGAGG AGGCCAAGAA GATGTTCCCC CAGGGATACA AGACGGTCGA TCTTCCTTCC GGGAAGAAGT ACATGCGTCT TGTCAAGGTG GATTAGATGT 
GTGAAGTCCT GAGTCTTATA TGACTTATCT GCGTGGAAGT AATAATATTA GTAGAGCTTG TT 

Retrieve as FASTA