Entry information : Sm2CysPrx02-2_18 (Sm2CysPrx02b_18)
Entry ID 7381
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: Sm2CysPrx02-2_18 (Sm2CysPrx02b_18)
Name (synonym) Sm2CysPrx02-2_18 (Sm2CysPrx02b_18)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sm2CysPrx02-2_18
start..stop
S start..stop
Sm2CysPrx02-1_34 547 0 1..286 1..291
Spol2CysPrx01 323 2e-112 62..286 23..251
Nt2CysPrx01-1A 323 4e-112 97..286 78..271
Zm2CysPrx01 321 2e-111 95..286 65..260
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2038790..2039035 246 N° 2 2039065..2039170 106 N° 3 2039226..2039307 82 N° 4 2039365..2039444 80
N° 5 2039497..2039622 126 N° 6 2039736..2039849 114 N° 7 2039901..2040005 105  
join(2038790..2039035,2039065..2039170,2039226..2039307,2039365..2039444,2039497 ..2039622,2039736..2039849,2039901..2040005)


exon

Literature and cross-references Sm2CysPrx02-2_18 (Sm2CysPrx02b_18)
DNA ref. Phytozome 11:   scaffold_18 (2038790..2040005)
Protein sequence: Sm2CysPrx02-2_18 (Sm2CysPrx02b_18)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   286
PWM (Da):   %s   31502.55  
PI (pH):   %s   8.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALGLGVQAISIASTSLVEEKRGSAIPERQCERVAFARRISPHELLQLCSSRERENAVGVRFRRRKRNVIAAGAPAPPPPSQTIDFDLHKSXQIDRPLVGSMAPNFEAEAVHHQEFIKVKLSNYIGKKFVVLFFYPLNFTFVCPTELTAFSDRYGEFQKLDTEVLAVSSDEFSHLAWIQTDRKSGGLGELNYPVVSDLTKAITKAYRVLLPDQGISLRGLFIIDKEGIVQHATINNLAVGRNVDEALRLVQAVQYVKVHPDELCPAGWQPGEHGIKPDPKHFAX

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Frame shift. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTAGGGTTAGGGGTTCAAGCGATCTCGATTGCTTCTACGTCGCTGGTGGAGGAGAAGCGAGGATCAGCGATTCCGGAGCGCCAGTGCGAGCGCGTAGCATTCGCGAGAAGAATC
TCTCCGCATGAACTTTTGCAGCTATGCTCGTCAAGAGAAAGGGAGAATGCCGTGGGAGTGAGGTTTAGAAGGAGAAAGAGAAATGTGATTGCCGCGGGAGCGCCAGCGCCTCCGCCTCCA
TCGCAG
GTATGTTTGAATTCCTTTACTTTTTCCAGACTATAGATTTTGACTTGCATAAGTCATNNCAGATAGATCGGCCTTTGGTGGGTAGCATGGCACCAAACTTTGAAGCCGAGGCTG
TCCATCACCAAGAGTTTATCA
AGGTACAAAAATCTCTACATGTTTTCCAAAAACTCGATTTGAGTTTGTTCTTGGCAGGTCAAGCTTTCCAATTACATTGGAAAGAAGTTCGTTGTTCTT
TTCTTCTACCCCCTCAATTTCACCTTCGTTTGCCCGAC
AGGTATCTTGCTTTTTCTTTGAAACTTTGTTTCATTCTCTGCGTGTGTGTTTTCAACAGAGCTAACAGCGTTCAGCGATCGG
TACGGTGAGTTTCAAAAGCTCGACACTGAGGTGCTCGCAGTATCATCCGACAGTG
TAGTAAGCTCAAAATCCATTATCACTGGTTCTGTCCTTGACATTTTCCTTCCAGTTCTCTCACCT
AGCGTGGATCCAAACTGACCGGAAGTCTGGGGGACTTGGGGAACTCAATTACCCAGTTGTTTCGGATCTGACCAAGGCAATCACCAAAGCCTATCGCGTGTTGCTACCCGACC
AGGTCTT
TCTATTCACTCACCGATCACACACATAGAACATAAGAGGCAAGGCAAGAACACATTTTTAAGTCTCTCGCAACTACAGATGGCCTTAACCTTTGCATAAAAACCACAGGGTATTTCCTTG
AGAGGATTGTTTATAATCGACAAGGAAGGCATCGTTCAGCATGCTACAATCAACAATCTTGCTGTTGGACGCAACGTTGACGAGGCCCTCAGGCTTGTCC
AGGTAACTTCACTCGTTCTA
TATGTTTCACGTCGACAAAATCGTTTCTTTTAGGCCGTCCAATACGTGAAAGTGCATCCGGACGAGCTATGTCCAGCGGGCTGGCAGCCTGGGGAGCACGGGATTAAACCAGATCCAAAG
CACTTTGCTGCTGTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTAGGGTTAGGGGTTCAAGCGATCTCGATTGCTTCTACGTCGCTGGTGGAGGAGAAGCGAGGATCAGCGATTCCGGAGCGCCAGTGCGAGCGCGTAGCATTCGCGAGAAGAATC
TCTCCGCATGAACTTTTGCAGCTATGCTCGTCAAGAGAAAGGGAGAATGCCGTGGGAGTGAGGTTTAGAAGGAGAAAGAGAAATGTGATTGCCGCGGGAGCGCCAGCGCCTCCGCCTCCA
TCGCAG
ACTATAGATTTTGACTTGCATAAGTCATNNCAGATAGATCGGCCTTTGGTGGGTAGCATGGCACCAAACTTTGAAGCCGAGGCTGTCCATCACCAAGAGTTTATCAAGGTCAAG
CTTTCCAATTACATTGGAAAGAAGTTCGTTGTTCTTTTCTTCTACCCCCTCAATTTCACCTTCGTTTGCCCGAC
AGAGCTAACAGCGTTCAGCGATCGGTACGGTGAGTTTCAAAAGCTC
GACACTGAGGTGCTCGCAGTATCATCCGACAGTG
AGTTCTCTCACCTAGCGTGGATCCAAACTGACCGGAAGTCTGGGGGACTTGGGGAACTCAATTACCCAGTTGTTTCGGATCTGACC
AAGGCAATCACCAAAGCCTATCGCGTGTTGCTACCCGACC
AGGGTATTTCCTTGAGAGGATTGTTTATAATCGACAAGGAAGGCATCGTTCAGCATGCTACAATCAACAATCTTGCTGTT
GGACGCAACGTTGACGAGGCCCTCAGGCTTGTCC
AGGCCGTCCAATACGTGAAAGTGCATCCGGACGAGCTATGTCCAGCGGGCTGGCAGCCTGGGGAGCACGGGATTAAACCAGATCCA
AAGCACTTTGCTGCTGTCT

Retrieve as FASTA