Entry information : SmPrxQ-2_31 (SmPrxQb_31)
Entry ID 7383
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-05-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrxQ-2_31 (SmPrxQb_31)
Name (synonym) SmPrxQ-2_31 (SmPrxQb_31)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxQ-2_31
start..stop
S start..stop
SmPrxQ-1_21 444 1e-161 1..220 1..220
PabPrxQ23 278 4e-96 62..220 57..219
PabPrxQ22 271 2e-93 44..220 38..219
GbPrxQ01 265 4e-91 63..220 66..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 310605..310820 216 N° 2 310351..310488 138 N° 3 310210..310299 90 N° 4 309427..309645 219
complement(join(309427..309645,310210..310299,310351..310488,310605..310820))


exon

Literature and cross-references SmPrxQ-2_31 (SmPrxQb_31)
DNA ref. Phytozome 11:   scaffold_31 (310820..309427)
mRNA ref. JGI transcript:   443212
EST ref. GenBank:   828   DN839008.1
Protein sequence: SmPrxQ-2_31 (SmPrxQb_31)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   23528.12  
PI (pH):   %s   9.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAAPLCGGAVLAAAAPRKSPASSSCAAILRPPCLASSSIAAESSLFRRVCGLGVAKSPSRTLLSTSCKLSQGDVLPSFNLKDQEGRVVNSSKFKNKPVVLYFYPADESPGCTKEACAFRDSYDKFRKAGAEVIGISADTPESHKAFAKKYRLPFTLLTDEGNKLRKDWGIPGDFFGSLPGRQTYVIDKKGVVRLVFNNQFQPEKHAMETLKVLESM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and ESTs. Unigene compiles ESTs from both haplotypes.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCGTCAGCGGCTCCGCTCTGTGGAGGAGCAGTGCTCGCCGCCGCTGCGCCTCGCAAATCCCCGGCATCCTCCTCCTGCGCAGCGATTCTCCGGCCTCCATGCCTCGCCAGC
TCGTCAATCGCCGCGGAATCCAGCTTGTTTCGCAGGGTTTGCGGCCTGGGAGTCGCGAAATCGCCGTCCAGGACGCTTCTTTCCACGAGCTGCAAG
GTAAGATGCCCGCATTGCGAGGAT
TTTCTCAAAAAAATTTCGAGTGCCAATCTTGGGATGGATGGATTCCTGAGAAGATTCATAGTGTAGGGCTCTGAGCAAGGGATTACGTGCAGCTGAGCCAGGGCGATGTTCTCCCCTCGT
TCAATCTCAAGGACCAGGAGGGGCGAGTGGTGAATTCATCCAAGTTTAAGAACAAGCCTGTGGTCTTGTACTTCTATCCGGCCGATGAGTCGCCAGGATGCACCAAAGAG
GTAGGAAAAA
TAAAATAAAATCCTTGCCTTGTCTAATCTCTGATCGATCAGGCTTGCGCGTTTCGGGATTCTTACGATAAATTCAGGAAGGCTGGAGCGGAAGTGATTGGCATCAGTGCCGATACTCCAG
AGTCTCACAAG
GTACATTGCTTGATTCCCAGCTTCTTTCGTCTTCCAAGGTCTTAGAGATCTTAGAATTTGGACTGCTGGATTGGTTTTGTGTGAGAGTTTTTACGAGCTTTTCGAAGTG
GTCACTGATAAGCTCTTAGCTTTTGTGCTCGAAAGTTTCAAGATTGGATTGGGTTTTGAGAGAGTTTCTCGATCAACTTTGCTGATAGTTTCTGGCCAGCCGATCGAAGCTTTTTGCTTT
TGAAAGTTTCAGATTATACCAGATTGGATTGTGATATACTTGGTTTTGTGTTTCCATACATCGTGAGAGTTTCCCCGAGTGTTCACTCTAATAGTTTCTGGCCAGCCGATCGACGCTTTC
AGCTTTGTGCTCAAATGTTTCAGAGATCTTCCAGTTTTGCGAGTTCCGTTAGATCATTTGCTAAGAATTTTGTTCCCTAGAGATTGGATTGTGTTTCCAATCTTGGTGAGAGTATTTATG
AGTTCTCTGATAGTTTCTGGCCAGCCGATCGAAGTATTTAGCTTTAGTGCTCCAAAGTTTCAGAGTTCTAACGTTGGATCTTTCGCTATTCGCAGGCATTTGCGAAGAAATACCGGCTTC
CATTCACGCTGCTCACCGACGAAGGAAACAAGCTGAGAAAGGACTGGGGAATCCCCGGCGACTTCTTTGGCTCGCTGCCGGGAAGGCAAACTTACGTGATCGACAAAAAAGGTGTTGTGC
GGCTCGTCTTCAACAACCAGTTCCAGCCCGAGAAGCACGCCATGGAGACGCTCAAGGTTCTCGAAAGCATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCGTCAGCGGCTCCGCTCTGTGGAGGAGCAGTGCTCGCCGCCGCTGCGCCTCGCAAATCCCCGGCATCCTCCTCCTGCGCAGCGATTCTCCGGCCTCCATGCCTCGCCAGC
TCGTCAATCGCCGCGGAATCCAGCTTGTTTCGCAGGGTTTGCGGCCTGGGAGTCGCGAAATCGCCGTCCAGGACGCTTCTTTCCACGAGCTGCAAG
CTGAGCCAGGGCGATGTTCTCCCC
TCGTTCAATCTCAAGGACCAGGAGGGGCGAGTGGTGAATTCATCCAAGTTTAAGAACAAGCCTGTGGTCTTGTACTTCTATCCGGCCGATGAGTCGCCAGGATGCACCAAAGAG
GCTTGC
GCGTTTCGGGATTCTTACGATAAATTCAGGAAGGCTGGAGCGGAAGTGATTGGCATCAGTGCCGATACTCCAGAGTCTCACAAG
GCATTTGCGAAGAAATACCGGCTTCCATTCACGCTG
CTCACCGACGAAGGAAACAAGCTGAGAAAGGACTGGGGAATCCCCGGCGACTTCTTTGGCTCGCTGCCGGGAAGGCAAACTTACGTGATCGACAAAAAAGGTGTTGTGCGGCTCGTCTTC
AACAACCAGTTCCAGCCCGAGAAGCACGCCATGGAGACGCTCAAGGTTCTCGAAAGCATGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCAATAAAC CGGGAGAGCT TTGAAAGCAA AGAAGCCCAA AACCATGGCT TCTTCGTCAG CGGCTCCGCT CTGTGGAGGA GCAGTGCTCG CCGCCGCTGC GCCTCGCAAA TCCCCGGCAT  CCTCCTCCTG CGCAGCGATT CTCCGGCCTC CATGCCTCGC CAGCTCGTCA ATCGCCGCGG AATCCAGCTT GTTTCGCAGG GTTTGCGGCC TGGGAGTCGC GAAATCGCCG TCCAGGACGC  TTCTTTCCAC GAGCTGCAAG CTGAGCCAGG GCGATGTTCT CCCCTCGTTC AATCTCAAGG ACCAGGAGGG GCGAGTGGTG AATTCATCCA AGTTTAAGAA CAAGCCTGTG GTCTTGTACT  TCTATCCGGC CGATGAGTCG CCAGGATGCA CCAAAGAGGC TTGCGCGTTT CGGGATTCTT ACGATAAATT CAGGAAGGCT GGAGCGGAAG TGATTGGCAT CAGTGCCGAT ACTCCAGAGT  CTCACAAGGC ATTTGCGAAG AAATACCGGC TTCCATTCAC GCTGCTCACC GACGAAGGAA ACAAGCTGAG AAAGGACTGG GGAATCCCCG GCGACTTCTT TGGCTCGCTG CCGGGAAGGC  AAACTTACGT GATCGACAAA AAAGGTGTTG TGCGGCTCGT CTTCAACAAC CAGTTCCAGC CCGAGAAGCA CGCCATGGAG ACGCTCAAGG TTCTCGAAAG CATGTAAAGA AAAGCCGCCA  TTCTTTTCAT CGCACCTTCC CTTCTATATA AATATGTAAA ACCCGATGTT GCTGTGGACT TCTCCACGCA AAAAATCTCT TGGAATGAAA AATTCCAAGC TTTGCCTGCT ATAATCTCTC 
GCAGTGGAAT GCTTTAGT 

Retrieve as FASTA