Entry information : SmGPx02-2_57 (SmGPx02b_57)
Entry ID 7402
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmGPx02-2_57 (SmGPx02b_57)
Name (synonym) SmGPx02-2_57 (SmGPx02b_57)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx02-2_57
start..stop
S start..stop
SmGPx02-1_0 336 8e-121 1..166 1..166
AcvGPx06-2 263 7e-92 3..166 2..165
GgGPx06 258 5e-90 2..166 3..166
MtGPx06 256 4e-88 1..166 67..231
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 785443..785490 48 N° 2 785309..785385 77 N° 3 785194..785255 62 N° 4 785022..785140 119
N° 5 784792..784962 171 N° 6 784714..784792 79  
complement(join(784714..784792,784792..784962,785022..785140,785194..785255,7853 09..785385,785443..785490))


exon

Literature and cross-references SmGPx02-2_57 (SmGPx02b_57)
DNA ref. JGI genome:   scaffold_57 (785490..784714)
mRNA ref. JGI transcript:   118012 [Incorrect prediction]
EST ref. GenBank:   FE462082.1
Cluster/Prediction ref. UniGene:   Smo.1482
Protein sequence: SmGPx02-2_57 (SmGPx02b_57)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18271.28  
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSDKPSSIYDITVKDATGNDVSLGSYKDKVLLIVNVASQCGFTTTNYKELNELYEKYKDGFEILAFPCNQFAGQEPGSNEEIQQTVCTRFKAEFPVFGVNVNGADTAPVFKYLKSAKGGGIFGDFIKWNFSKFLVSKTGEVVERYAPTTNPSKIEGQFLAALLSFGALTSFLAEGYPEAX

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and ESTs. Incorrect prediction from JGI
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTCTTCGGATAAGCCCTCTAGCATCTACGACATTACTGTCAAGGTTCGCTCGTTTATACATCTCTCCAATTGTCTAGAAGTTCTTCCCATTGTTTTACAGGATGCTACAGGAAAC
GATGTTTCTCTCGGCAGCTACAAGGACAAAGTTCTCCTGATTGTAAACGTTGCATCGCAATG
GTATGTTTGTTGTCAATCGAGGTGTGCTCTAACCGGTTTTTCTTCTTCGGCAGTGGCT
TCACTACAACCAATTACAAAGAACTCAACGAGCTCTACGAGAAGTACAAGGACAAGG
GTATGAATTTCTTTTTTCTGGCTGTGAAACTTATGAGCTCTCTCTGACTCCAGGCTTTGAGAT
CCTGGCCTTTCCGTGTAACCAGTTTGCCGGGCAAGAGCCTGGCTCTAACGAAGAAATCCAGCAAACCGTGTGTACTCGATTCAAGGCCGAGTTCCCGGTTTTTGGGAAA
GTAAGTGGTGA
TTATCTTTTCAGTTCTCTCCTAATTTTTCCATCGTGGTGTTGTGTCAGGTGAACGTGAATGGAGCAGACACAGCTCCTGTTTTTAAGTACCTCAAGTCTGCCAAGGGTGGGGGCATTTTC
GGCGACTTTATCAAGTGGAACTTCAGCAAGTTTCTGGTGAGCAAGACTGGTGAAGTTGTTGAGCGCTATGCTCCAACTACAAACCCATCCAAAATCGAG
TGAGCTCTTCGGATAAGCCCT
CTAGCATCTACGACATTACTGTCAAGGTTCGCTCGTTTATACATCTCTCCAATTGTCTAGAAGTTCTTCCCATTGTTTTACAGGATGCTACAGGAAACGATGTTTCTCTCGGCAGCTACA
AGGACAAAGTTCTCCTGATTGTAAACGTTGCATCGCAATGGTATGTTTGTTGTCAATCGAGGTGTGCTCTAACCGGTTTTTCTTCTTCGGCAGTGGCTTCACTACAACCAATTACAAAGA
ACTCAACGAGCTCTACGAGAAGTACAAGGACAAGGGTATGAATTTCTTTTTTCTGGCTGTGAAACTTATGAGCTCTCTCTGACTCCAGGCTTTGAGATCCTGGCCTTTCCGTGTAACCAG
TTTGCCGGGCAAGAGCCTGGCTCTAACGAAGAAATCCAGCAAACCGTGTGTACTCGATTCAAGGCCGAGTTCCCGGTTTTTGGGAAAGTAAGTGGTGATTATCTTTTCAGTTCTCTCCTA
ATTTTTCCATCGTGGTGTTGTGTCAGGTGAACGTGAATGGAGCAGACACAGCTCCTGTTTTTAAGTACCTCAAGTCTGCCAAGGGTGGGGGCATTTTCGGCGACTTTATCAAGTGGAACT
TCAGCAAGTTTCTGGTGAGCAAGACTGGTGAAGTTGTTGAGCGCTATGCTCCAACTACAAACCCATCCAAAATCGAGGTCAATTTCTTGCCGCGCTACTCTCTTTCGGTGCACTAACTTC
TTTTCTTGCAGAAGGATATCCTGAAGCTTCTGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGCAATCCAG ACACAAGAAT CCACAGCTAG TTTTTAACGT ACCAGCGAAT GATACTTAGT GCATATTCCT CATATATATC GTTGGTTCTT GTGCTCTTGG TATCTTTGTA TTGGAGGAAC  CCTTCGCTTT TTCACGACTC TGCAAGAATC TTCTCGCCGA ATTATCGGAA CATGAGCTCT TCGGATAAGC CCTCTAGCAT CTACGACATT ACTGTCAAGG ATGCTACAGG AAACGATGTT  TCTCTCGGCA GCTACAAGGA CAAAGTTCTC CTGATTGTAA ACGTTGCATC GCAATGTGGC TTCACTACAA CCAATTACAA AGAACTCAAC GAGCTCTACG AGAAGTACAA GGACAAGGGC  TTTGAGATCC TGGCCTTTCC GTGTAACCAG TTTGCCGGGC AAGAGCCTGG CTCTAACGAA GAAATCCAGC AAACCGTGTG TACTCGATTC AAGGCCGAGT TCCCGGTTTT TGGGAAAGTG  AACGTGAATG GAGCAGACAC AGCTCCTGTT TTTAAGTACC TCAAGTCTGC CAAGGGTGGG GGCATTTTCG GCGACTTTAT CAAGTGGAAC TTCAGCAAGT TTCTGGTGAG CAAGACTGGT  GAAGTTGTTG AGCGCTATGC TCCAACTACA AACCCATCCA AAATCGAGAA GGATATCCTG AAGCTTCTGT GAGCTTCGTG TGTGAnAGCA AAGGTACACC AGTAAAGTTA CAATAAAGAA 
AGGCTATCAT CGTCTGTGAG TG 

Retrieve as FASTA