Entry information : SmGPx01-2_12 (SmGPx01b_12)
Entry ID 7404
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmGPx01-2_12 (SmGPx01b_12)
Name (synonym) SmGPx01-2_12 (SmGPx01b_12)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2008]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx01-2_12
start..stop
S start..stop
SmGPx01-1_0 351 1e-126 1..168 1..168
HbGPx02 243 5e-84 1..165 1..166
HaGPx06 241 4e-83 2..165 3..166
ThasGPx03 238 1e-81 3..165 35..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 261144..261185 42 N° 2 261016..261092 77 N° 3 260891..260952 62 N° 4 260724..260842 119
N° 5 260502..260669 168 N° 6 260399..260437 39  
complement(join(260399..260437,260502..260669,260724..260842,260891..260952,2610 16..261092,261144..261185))


exon

Literature and cross-references SmGPx01-2_12 (SmGPx01b_12)
DNA ref. JGI genome:   scaffold_12 (261185..260399)
mRNA ref. JGI transcript:   170545
Cluster/Prediction ref. UniGene:   Smo.284
Protein sequence: SmGPx01-2_12 (SmGPx01b_12)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18797.51  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQSGSSIYDLTVQDIDGKDVPLSQYKGKVMLIVNVASQCGYTNDAYKEMNELYAKYKDGFEILAFPCNQFGNQEPGSNEEIKERACTRFKAEFPIFQVDVNGSHTAPLFKLLKTEKGGFLVDAVKWNFTKFLVNRKGEVVEREGPSTSPLKMEKHIKKWLDAPAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 7 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCAGAGTGGTAGCAGCATCTACGATCTCACCGTGCAGGCAAGTGTTTCTTTTTTCTATCTACCTCGATCATTTTTTATCCTCTAACAGGACATCGACGGCAAGGATGTTCCTCTC
AGCCAGTACAAAGGCAAGGTTATGCTCATCGTCAATGTGGCGTCTCAGTG
GTATGTTCACCGTCTCTTGTGATTTTCATTCCCGTGAAATTCATTCCTCTCTTCTTGTGGCAGTGGATAC
ACAAATGACGCTTACAAGGAGATGAATGAGCTCTATGCCAAGTACAAGGATAGCG
GTGAGTGGTATCCTGTTTTGTTGCTGAAGTTACAATCTTCTTTGGCAGGCTTCGAGATCCTGGCA
TTTCCTTGCAACCAATTCGGCAACCAAGAGCCTGGCTCAAACGAAGAGATCAAGGAACGAGCTTGCACTCGTTTCAAAGCTGAGTTTCCCATCTTTCAGAAA
GTAAGTTTGGTACCTTTT
TTTGTGTTTTCTGCATCAACTGGTTTGTGCTTTCAGGTGGATGTTAATGGAAGCCACACCGCACCGCTTTTCAAGCTGCTTAAAACTGAAAAGGGGGGATTTCTGGTTGATGCTGTCAAG
TGGAACTTCACGAAGTTCCTGGTGAATAGAAAGGGCGAGGTCGTGGAGCGTGAGGGTCCATCAACAAGCCCTCTGAAAATGGAG
GTACGTGGAAGTTAAAAGCATAGTTCTGTTGGGTCT
CACAAGATCATCATCTTATTGTCCGCAGAAGCACATCAAGAAATGGCTAGACGCTCCTGCAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCAGAGTGGTAGCAGCATCTACGATCTCACCGTGCAGGACATCGACGGCAAGGATGTTCCTCTCAGCCAGTACAAAGGCAAGGTTATGCTCATCGTCAATGTGGCGTCTCAGTGT
GGATACACAAATGACGCTTACAAGGAGATGAATGAGCTCTATGCCAAGTACAAGGATAGCG
GCTTCGAGATCCTGGCATTTCCTTGCAACCAATTCGGCAACCAAGAGCCTGGCTCAAAC
GAAGAGATCAAGGAACGAGCTTGCACTCGTTTCAAAGCTGAGTTTCCCATCTTTCAGAAA
GTGGATGTTAATGGAAGCCACACCGCACCGCTTTTCAAGCTGCTTAAAACTGAAAAGGGG
GGATTTCTGGTTGATGCTGTCAAGTGGAACTTCACGAAGTTCCTGGTGAATAGAAAGGGCGAGGTCGTGGAGCGTGAGGGTCCATCAACAAGCCCTCTGAAAATGGAG
AAGCACATCAAG
AAATGGCTAGACGCTCCTGCAGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTACATGTAG GTACAAAATG CTCCGCTTTG TCTAGGGCTT TATCACAATG GCGCAGAGTG GTAGCAGCAT CTACGATCTC ACCGTGCAGG ACATCGACGG CAAGGATGTT CCTCTCAGCC  AGTACAAAGG CAAGGTTATG CTCATCGTCA ATGTGGCGTC TCAGTGTGGA TACACAAATG ACGCTTACAA GGAGATGAAT GAGCTCTATG CCAAGTACAA GGATAGCGGC TTCGAGATCC  TGGCATTTCC TTGCAACCAA TTCGGCAACC AAGAGCCTGG CTCAAACGAA GAGATCAAGG AACGAGCTTG CACTCGTTTC AAAGCTGAGT TTCCCATCTT TCAGAAAGTG GATGTTAATG  GAAGCCACAC CGCACCGCTT TTCAAGCTGC TTAAAACTGA AAAGGGGGGA TTTCTGGTTG ATGCTGTCAA GTGGAACTTC ACGAAGTTCC TGGTGAATAG AAAGGGCGAG GTCGTGGAGC  GTGAGGGTCC ATCAACAAGC CCTCTGAAAA TGGAGAAGCA CATCAAGAAA TGGCTAGACG CTCCTGCAGC TTGAGAATTA GTGAAAGCCT TTGTTTCTAT TTCCTACTAT CATGAATAAA 
ACTAAACTTG TAT 

Retrieve as FASTA