Entry information : SmGPx01-1_0 (SmGPx01a_0)
Entry ID 7405
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-09-24 (Christophe Dunand)
Peroxidase information: SmGPx01-1_0 (SmGPx01a_0)
Name (synonym) SmGPx01-1_0 (SmGPx01a_0)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2008]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx01-1_0
start..stop
S start..stop
SmGPx01-2_12 351 1e-126 1..168 1..168
HbGPx02 243 5e-84 1..165 1..166
HaGPx06 241 4e-83 2..165 3..166
ThasGPx03 238 1e-81 3..165 35..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5532317..5532358 42 N° 2 5532189..5532265 77 N° 3 5532064..5532125 62 N° 4 5531897..5532015 119
N° 5 5531674..5531841 168 N° 6 5531571..5531609 39  
complement(join(5531571..5531609,5531674..5531841,5531897..5532015,5532064..5532 125,5532189..5532265,5532317..5532358))


exon

Literature and cross-references SmGPx01-1_0 (SmGPx01a_0)
DNA ref. JGI genome:   scaffold_0 (5532358..5531571)
mRNA ref. JGI transcript:   140057
EST ref. GenBank:   DN838361.1
Protein sequence: SmGPx01-1_0 (SmGPx01a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18797.51  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQSGSSIYDLTVQDIDGKDVPLSQYKGKVMLIVNVASQCGYTNDAYKEMNELYAKYKDGFEILAFPCNQFGNQEPGSNEEIKERACTRFKAEFPIFQVDVNGSHTAPLFKLLKTEKGGFLVDAVKWNFTKFLVNRKGEVVEREGPSTSPLKMEKHIKKWLDAPAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCAGAGTGGTAGCAGCATCTACGATCTCACCGTGCAGGCAAGTGTTTCTTTTTTCTATCTACCTCGCTCATTTTTTATCCTCTAACAGGACATCGACGGCAAGGATGTTCCTCTC
AGCCAGTACAAAGGCAAGGTTATGCTCATCGTCAATGTGGCGTCTCAGTG
GTATGTTCACCGTCTCTTGTGATTTTCATTCCCGTGAAATTCATTCCTCTCTTCTTGTGGCAGTGGATAC
ACAAATGACGCTTACAAGGAGATGAACGAGCTCTATGCCAAGTACAAGGATAGCG
GTGAGTGGTATCCTGTTTTGTTGCTGAAGTTACAATCTTCTTTGGCAGGCTTCGAGATCCTGGCA
TTTCCTTGCAACCAATTCGGCAACCAAGAGCCTGGCTCAAACGAAGAGATCAAGGAACGAGCTTGCACTCGTTTCAAAGCTGAGTTTCCCATCTTTCAGAAA
GTAAGTTTGGTACCTTTT
TTTTGTGTTTTCTGCATCAACTGGTTTGTGCTTTCAGGTGGATGTTAATGGAAGCCACACCGCACCGCTTTTCAAGCTGCTTAAAACTGAAAAGGGGGGATTTCTGGTTGATGCTGTCAA
GTGGAACTTCACGAAGTTCCTGGTGAATAGAAAGGGCGAGGTCGTGGAGCGTGAGGGTCCATCAACAAGCCCTCTGAAAATGGAG
GTACGTGGAAGTTAAAAGCATAGTTCTGTTGGGTC
TCACAAGATCATCATCTTATTGTCCGCAGAAGCACATCAAGAAATGGCTAGACGCTCCTGCAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCAGAGTGGTAGCAGCATCTACGATCTCACCGTGCAGGACATCGACGGCAAGGATGTTCCTCTCAGCCAGTACAAAGGCAAGGTTATGCTCATCGTCAATGTGGCGTCTCAGTGT
GGATACACAAATGACGCTTACAAGGAGATGAACGAGCTCTATGCCAAGTACAAGGATAGCG
GCTTCGAGATCCTGGCATTTCCTTGCAACCAATTCGGCAACCAAGAGCCTGGCTCAAAC
GAAGAGATCAAGGAACGAGCTTGCACTCGTTTCAAAGCTGAGTTTCCCATCTTTCAGAAA
GTGGATGTTAATGGAAGCCACACCGCACCGCTTTTCAAGCTGCTTAAAACTGAAAAGGGG
GGATTTCTGGTTGATGCTGTCAAGTGGAACTTCACGAAGTTCCTGGTGAATAGAAAGGGCGAGGTCGTGGAGCGTGAGGGTCCATCAACAAGCCCTCTGAAAATGGAG
AAGCACATCAAG
AAATGGCTAGACGCTCCTGCAGCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CACTTTGTCT AGGGCTTTAT CACAATGGCG CAGAGTGGTA GCAGCATCTA CGATCTCACC GTGCAGGACA TCGACGGCAA GGATGTTCCT CTCAGCCAGT ACAAAGGCAA GGTTATGCTC  ATCGTCAATG TGGCGTCTCA GTGTGGATAC ACAAATGACG CTTACAAGGA GATGAACGAG CTCTATGCCA AGTACAAGGA TAGCGGCTTC GAGATCCTGG CATTTCCTTG CAACCAATTC  GGCAACCAAG AGCCTGGCTC AAACGAAGAG ATCAAGGAAC GAGCTTGCAC TCGTTTCAAA GCTGAGTTTC CCATCTTTCA GAAAGTGGAT GTTAATGGAA GCCACACCGC ACCGCTTTTC  AAGCTGCTTA AAACTGAAAA GGGGGGATTT CTGGTTGATG CTGTCAAGTG GAACTTCACG AAGTTCCTGG TGAATAGAAA GGGCGAGGTC GTGGAGCGTG AGGGTCCATC AACAAGCCCT 
CTGAAAATGG AGAAGCACAT CAAGAAATGG CTAGACGCTC CTGCAGCTTG AGAATTAGTG AAAGCCTTTG TTTCTATTTC CTACTATCAT GAATAAAATT AAACTTGTAT CTGT 

Retrieve as FASTA