Entry information : SmGPx03-2_107 (SmGPx03b_107)
Entry ID 7406
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmGPx03-2_107 (SmGPx03b_107)
Name (synonym) SmGPx03-2_107 (SmGPx03b_107)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx03-2_107
start..stop
S start..stop
SmGPx03-1_40 495 0 1..245 1..245
ZaGPx04 288 2e-99 45..245 42..242
LuGPx140 288 2e-99 40..245 39..242
WnoGPx01 286 9e-99 51..245 50..241
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 189088..189375 288 N° 2 189430..189506 77 N° 3 189578..189639 62 N° 4 189693..189811 119
N° 5 189867..190034 168 N° 6 190091..190114 24  
join(189088..189375,189430..189506,189578..189639,189693..189811,189867..190034, 190091..190114)


exon

Literature and cross-references SmGPx03-2_107 (SmGPx03b_107)
DNA ref. Phytozome 11:   scaffold_107 (189088..190114)
mRNA ref. JGI transcript:   16028 [Incorrect prediction]
EST ref. GenBank:   FE516739.1
Cluster/Prediction ref. UniGene:   Smo.1088
Protein sequence: SmGPx03-2_107 (SmGPx03b_107)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   245
PWM (Da):   %s   26133.69  
PI (pH):   %s   10.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALVSVSLVPSSRGALVSTSATAVSGSRPRKVWLPHFPRAAASNPALVASKSSVFGRRLALGAVGAGVAAQIAWGAGKAFASTATKEKSIHDFTVKNIDGKDIDLSMYKGKVLLVVNIASQCGLTSGNYKELVEVHKKYKDGFEVLAFPCNQFGGQEPGTNEEIKQFACTRYKAEFPIFDVDVNGPSTAPVYQFLKSSKGGLLGDSIKWNFGKFLVNKDGQVVERYAPTTSPFQIEGDIKKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 24 ESTs. Incorrect prediction from JGI (5' and last exon are missing). Unigene compiles ESTs from both haplotypes.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTTGTCTCGGTATCGCTCGTGCCCTCGTCGCGTGGAGCTCTCGTCTCCACATCGGCCACAGCTGTCTCTGGATCCAGGCCTCGCAAGGTTTGGCTCCCGCATTTCCCTCGAGCT
GCCGCCTCGAATCCGGCGCTGGTAGCGTCGAAATCGAGCGTGTTTGGGAGGAGATTGGCCCTTGGCGCTGTTGGAGCTGGCGTTGCAGCTCAGATTGCTTGGGGCGCGGGGAAGGCGTTT
GCTTCCACGGCGACCAAGGAGAAATCCATCCACGATTTCACTGTCAAG
GTATGGACGGGTCGATTTGATGTTCGGGATTTTGATGATTTGGTAAGACATTAGAATATCGATGGGAAAGAC
ATAGATTTGAGCATGTACAAGGGGAAAGTTCTACTCGTTGTCAACATTGCTTCTCAATG
GTGTGTGCTATAAACGTTTGAAAGCATCGGTTTTGACAAGGTTTTCTTTCTTTTTCTTATG
ATGTTTCCAGTGGATTGACTTCCGGGAACTATAAAGAATTGGTAGAGGTTCACAAGAAATACAAAGACCAAGGTAAGCTGTAAGCTACAAAATAAAACACTGCTCTTTCTTGTCTCTTGT
CTCAGGCTTTGAGGTTTTAGCATTTCCATGCAACCAGTTTGGTGGCCAGGAACCAGGAACTAATGAGGAAATCAAGCAGTTTGCGTGCACCAGATACAAGGCAGAGTTTCCAATCTTCGA
CAAG
GTAACTGCTTAAAGCGTTTTTTTTCCCTTCTCTAAGTCGTTTTTTTGCGATGAAGGTGGATGTGAATGGGCCATCGACAGCTCCAGTTTATCAATTCCTCAAGAGCAGCAAAGGCG
GATTGCTGGGCGATAGCATCAAATGGAATTTCGGTAAATTTCTAGTGAACAAAGATGGGCAAGTTGTGGAAAGATATGCTCCCACCACTTCTCCCTTCCAGATCGAG
GTAAGAACTCTTC
CTGATTTTTTTGTCTTTTCTCTCTAAACTATTGTCCTCCACAGGGCGACATTAAGAAGCTGCTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTTGTCTCGGTATCGCTCGTGCCCTCGTCGCGTGGAGCTCTCGTCTCCACATCGGCCACAGCTGTCTCTGGATCCAGGCCTCGCAAGGTTTGGCTCCCGCATTTCCCTCGAGCT
GCCGCCTCGAATCCGGCGCTGGTAGCGTCGAAATCGAGCGTGTTTGGGAGGAGATTGGCCCTTGGCGCTGTTGGAGCTGGCGTTGCAGCTCAGATTGCTTGGGGCGCGGGGAAGGCGTTT
GCTTCCACGGCGACCAAGGAGAAATCCATCCACGATTTCACTGTCAAG
AATATCGATGGGAAAGACATAGATTTGAGCATGTACAAGGGGAAAGTTCTACTCGTTGTCAACATTGCTTCT
CAATG
TGGATTGACTTCCGGGAACTATAAAGAATTGGTAGAGGTTCACAAGAAATACAAAGACCAAGGCTTTGAGGTTTTAGCATTTCCATGCAACCAGTTTGGTGGCCAGGAACCAGGA
ACTAATGAGGAAATCAAGCAGTTTGCGTGCACCAGATACAAGGCAGAGTTTCCAATCTTCGACAAG
GTGGATGTGAATGGGCCATCGACAGCTCCAGTTTATCAATTCCTCAAGAGCAGC
AAAGGCGGATTGCTGGGCGATAGCATCAAATGGAATTTCGGTAAATTTCTAGTGAACAAAGATGGGCAAGTTGTGGAAAGATATGCTCCCACCACTTCTCCCTTCCAGATCGAG
GGCGAC
ATTAAGAAGCTGCTATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCGATCCA TGGCGCTTGT CTCGGTATCG CTCGTGCCCT CGTCGCGTGG AGCTCTCGTC TCCACATCGG CCACAGCTGT CTCTGGATCC AGGCCTCGCA AGGTTTGGCT CCCGCATTTC  CCTCGAGCTG CCGCCTCGAA TCCGGCGCTG GTAGCGTCGA AATCGAGCGT GTTTGGGAGG AGATTGGCCC TTGGCGCTGT TGGAGCTGGC GTTGCAGCTC AGATTGCTTG GGGCGCGGGG  AAGGCGTTTG CTTCCACGGC GACCAAGGAG AAATCCATCC ACGATTTCAC TGTCAAGAAT ATCGATGGGA AAGACATAGA TTTGAGCATG TACAAGGGGA AAGTTCTACT CGTTGTCAAC  ATTGCTTCTC AATGTGGATT GACTTCCGGG AACTATAAAG AATTGGTAGA GGTTCACAAG AAATACAAAG ACCAAGGCTT TGAGGTTTTA GCATTTCCAT GCAACCAGTT TGGTGGCCAG  GAACCAGGAA CTAATGAGGA AATCAAGCAG TTTGCGTGCA CCAGATACAA GGCAGAGTTT CCAATCTTCG ACAAGGTGGA TGTGAATGGG CCATCGACAG CTCCAGTTTA TCAATTCCTC  AAGAGCAGCA AAGGCGGATT GCTGGGCGAT AGCATCAAAT GGAATTTCGG TAAATTTCTA GTGAACAAAG ATGGGCAAGT TGTGGAAAGA TATGCTCCCA CCACTTCTCC CTTCCAGATC 
GAGGGCGACA TTAAGAAGCT GCTATAAnAT TCTA 

Retrieve as FASTA