Entry information : SmGPx03-1_40 (SmGPx03a_40)
Entry ID 7407
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmGPx03-1_40 (SmGPx03a_40)
Name (synonym) SmGPx03-1_40 (SmGPx03a_40)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx03-1_40
start..stop
S start..stop
SmGPx03-2_107 495 0 1..245 1..245
LuGPx140 289 1e-99 40..245 39..242
ZaGPx04 287 5e-99 45..245 42..242
WnoGPx01 287 6e-99 51..245 50..241
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1392069..1392356 288 N° 2 1392411..1392487 77 N° 3 1392558..1392619 62 N° 4 1392673..1392791 119
N° 5 1392845..1393012 168 N° 6 1393068..1393091 24  
join(1392069..1392356,1392411..1392487,1392558..1392619,1392673..1392791,1392845 ..1393012,1393068..1393091)


exon

Literature and cross-references SmGPx03-1_40 (SmGPx03a_40)
DNA ref. Phytozome 11:   scaffold_40 (1392069..1393091)
mRNA ref. JGI transcript:   228619
EST ref. GenBank:   FE495237.1
Cluster/Prediction ref. UniGene:   Smo.1088
Protein sequence: SmGPx03-1_40 (SmGPx03a_40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   245
PWM (Da):   %s   26061.65  
PI (pH):   %s   10.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALVSASLVPSSRGALVSTSATAVSGSRPRKVWLPHFPRAAASNPALVASKSSVFGRRLALGAVGAGVAAQIAWGAGKAFASTATKEKSIHDFTVKNIDGKDIDLSTYKGKVLLVVNIASQCGLTSGNYKELVEVHKKYKDGFEVLAFPCNQFGGQEPGSNEEIKQFACTRYKAEFPIFDVDVNGPSTAPVYQFLKSSKGGLLGDSIKWNFGKFLVNKDGQVVERYAPTTSPFQIEGDIKKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 26 ESTs. Unigene compiles ESTs from both haplotypes.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTTGTCTCGGCATCGCTCGTGCCCTCGTCGCGTGGAGCTCTCGTCTCCACATCGGCCACAGCTGTCTCTGGATCCAGGCCTCGCAAGGTTTGGCTCCCGCATTTCCCTCGAGCT
GCCGCCTCGAATCCGGCGCTGGTAGCGTCGAAATCGAGCGTGTTTGGGAGGAGATTGGCCCTTGGCGCTGTTGGAGCTGGCGTTGCAGCTCAGATTGCTTGGGGCGCGGGGAAGGCGTTT
GCTTCCACGGCGACCAAGGAGAAATCCATCCACGATTTCACCGTCAAG
GTATGGATGGGTCGATTTGATGTTCGGGATTTTGATGATTTGGTAATACATTAGAATATCGATGGGAAAGAC
ATTGATTTGAGCACGTACAAGGGGAAAGTTCTACTCGTTGTCAACATTGCTTCTCAATG
GTGTGGGCTATAAACGTTTGAAAGCATCGGTTTGACAAGGTTTTCTTTCTTTTTCTTATGA
TGTTTCCAGTGGATTGACTTCCGGGAACTATAAAGAATTGGTAGAAGTTCACAAGAAATACAAAGACCAAGGTAAGCTGTAAGCTACAAAATAAAACACTGCTCTTTCTTGTCTCTTGTC
TCAGGCTTTGAGGTTTTAGCATTTCCATGCAACCAGTTTGGTGGTCAGGAACCAGGATCTAATGAGGAAATCAAGCAGTTTGCGTGCACCAGATACAAGGCAGAGTTTCCAATCTTCGAC
AAG
GTAACTGCTTAAAGCGTTTTTTCCCTTCTCTAAGTCGTTTTTTTGCGATGAAGGTGGATGTGAATGGGCCATCGACAGCTCCAGTTTATCAATTCCTCAAGAGCAGCAAAGGCGGAT
TGCTGGGCGATAGCATCAAATGGAATTTCGGTAAATTTCTAGTGAACAAAGATGGGCAAGTTGTGGAAAGATATGCTCCCACCACTTCTCCCTTCCAGATCGAG
GTAAGAACTCTTCCTG
ATTTTTGGTCTTTTCTCTCTAAACTATTGTCCTCCACAGGGCGACATTAAGAAGCTGCTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTTGTCTCGGCATCGCTCGTGCCCTCGTCGCGTGGAGCTCTCGTCTCCACATCGGCCACAGCTGTCTCTGGATCCAGGCCTCGCAAGGTTTGGCTCCCGCATTTCCCTCGAGCT
GCCGCCTCGAATCCGGCGCTGGTAGCGTCGAAATCGAGCGTGTTTGGGAGGAGATTGGCCCTTGGCGCTGTTGGAGCTGGCGTTGCAGCTCAGATTGCTTGGGGCGCGGGGAAGGCGTTT
GCTTCCACGGCGACCAAGGAGAAATCCATCCACGATTTCACCGTCAAG
AATATCGATGGGAAAGACATTGATTTGAGCACGTACAAGGGGAAAGTTCTACTCGTTGTCAACATTGCTTCT
CAATG
TGGATTGACTTCCGGGAACTATAAAGAATTGGTAGAAGTTCACAAGAAATACAAAGACCAAGGCTTTGAGGTTTTAGCATTTCCATGCAACCAGTTTGGTGGTCAGGAACCAGGA
TCTAATGAGGAAATCAAGCAGTTTGCGTGCACCAGATACAAGGCAGAGTTTCCAATCTTCGACAAG
GTGGATGTGAATGGGCCATCGACAGCTCCAGTTTATCAATTCCTCAAGAGCAGC
AAAGGCGGATTGCTGGGCGATAGCATCAAATGGAATTTCGGTAAATTTCTAGTGAACAAAGATGGGCAAGTTGTGGAAAGATATGCTCCCACCACTTCTCCCTTCCAGATCGAG
GGCGAC
ATTAAGAAGCTGCTATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATTATGCG TTGTGGAGCT CGATCCATGG CGCTTGTCTC GGCATCGCTC GTGCCCTCGT CGCGTGGAGC TCTCGTCTCC ACATCGGCCA CAGCTGTCTC TGGATCCAGG CCTCGCAAGG  TTTGGCTCCC GCATTTCCCT CGAGCTGCCG CCTCGAATCC GGCGCTGGTA GCGTCGAAAT CGAGCGTGTT TGGGAGGAGA TTGGCCCTTG GCGCTGTTGG AGCTGGCGTT GCAGCTCAGA  TTGCTTGGGG CGCGGGGAAG GCGTTTGCTT CCACGGCGAC CAAGGAGAAA TCCATCCACG ATTTCACCGT CAAGAATATC GATGGGAAAG ACATTGATTT GAGCACGTAC AAGGGGAAAG  TTCTACTCGT TGTCAACATT GCTTCTCAAT GTGGATTGAC TTCCGGGAAC TATAAAGAAT TGGTAGAAGT TCACAAGAAA TACAAAGACC AAGGCTTTGA GGTTTTAGCA TTTCCATGCA  ACCAGTTTGG TGGTCAGGAA CCAGGATCTA ATGAGGAAAT CAAGCAGTTT GCGTGCACCA GATACAAGGC AGAGTTTCCA ATCTTCGACA AGGTGGATGT GAATGGGCCA TCGACAGCTC  CAGTTTATCA ATTCCTCAAG AGCAGCAAAG GCGGATTGCT GGGCGATAGC ATCAAATGGA ATTTCGGTAA ATTTCTAGTG AACAAAGATG GGCAAGTTGT GGAAAGATAT GCTCCCACCA  CTTCTCCCTT CCAGATCGAG GGCGACATTA AGAAGCTGCT ATAAAATTCT AAACAGAGGT TTTGGTGTAA ATCCGATTGT GAGCATAATT AAGGAGCATG CGACTCTACT CCTACATGCA 
TGCAATTCAG TTCATTCTAG AAGTACGGAA GAACTTACTT TTTGAGAAAC CTTTAAACAT GGAGTGTCCA TAGACTGTT 

Retrieve as FASTA