Entry information : SmGPx04-1_19 (SmGPx04a_19)
Entry ID 7408
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmGPx04-1_19 (SmGPx04a_19)
Name (synonym) SmGPx04-1_19 (SmGPx04a_19)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2009]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx04-1_19
start..stop
S start..stop
SmGPx04-2_61 371 7e-134 1..186 1..186
SmGPx02-2_57 181 5e-59 18..172 8..166
LuGPx221 181 7e-59 19..172 13..169
SmGPx02-1_0 180 1e-58 18..172 8..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 304506..304583 78 N° 2 304640..304716 77 N° 3 304775..304836 62 N° 4 304910..305028 119
N° 5 305106..305264 159 N° 6 305315..305410 96  
join(304506..304583,304640..304716,304775..304836,304910..305028,305106..305264, 305315..305410)


exon

Literature and cross-references SmGPx04-1_19 (SmGPx04a_19)
DNA ref. Phytozome 11:   scaffold_19 (304506..305410)
mRNA ref. JGI transcript:   97488 [Incorrect prediction]
Protein sequence: SmGPx04-1_19 (SmGPx04a_19)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   22484.38  
PI (pH):   %s   5.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGDEEIVNMREPAYTFASIYEIDVRDKHGQKVSMSKYRDKVLLIVNVATKSACASSMYKELNELHVKYVDGLEILAFPCNQFAAQEPLRTEYLQETVSSRFGPHFPLFEVDVNGPNTAVLFRYLKDKSDGDRIRWNFTKFLINRTGGIAGRYAPHIPPYKLEEDIKSLLAVELPFEEEKRKNAAKEEEQEEEP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). No EST. Incorrect prediction from JGI (no PS, last exon is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGCGACGAAGAGATCGTGAACATGAGGGAGCCGGCCTATACTTTCGCCAGCATCTATGAGATCGATGTTAGGGTATGCTTCCTCCATCCAACTCGCGTTTGTTTTCATAGATCG
ATTGGTGATCACAGGACAAACACGGCCAAAAAGTTTCCATGAGTAAATACAGAGACAAGGTTCTTTTGATCGTCAATGTCGCCACAAAATCGTGTGTATCTCCTGTTCTCGATTGATTGC
ATTCTCCATTTCTCATATGATCCATCCAGGGCGTGTGCTTCAAGCATGTACAAGGAGCTCAACGAGCTCCACGTAAAATACGTGGACGAAGGTTCTTTTGATCTTGTGTTTCTTTCTCTG
GGATCCTCCAAACTATAGCTTCGATTGCAGTCGTGATTCGCCAGGGCTAGAGATTTTGGCATTCCCGTGCAACCAATTCGCTGCGCAAGAGCCACTCAGGACGGAATATCTTCAAGAGAC
AGTCTCTTCTCGATTTGGGCCACACTTCCCACTCTTTGAAAGG
GTACGAGAGATTTCTCACTGAGAATTGGATCCAATTCGAACACTTGATCGAGAATTTTGACGATGTTTGATCCACAG

GTGGATGTAAATGGCCCAAACACCGCAGTTCTCTTCAGGTACCTCAAGGACAAGAGCGATGGCGATCGAATTCGCTGGAATTTCACAAAGTTTTTGATCAATCGAACTGGTGGAATTGCT
GGGAGATACGCCCCTCACATACCACCATACAAATTGGAG
GTTGGCTCTTCCCATTCTAGCATTTCTTCATCAATTTTCTTTGACATCAGGAAGATATCAAGAGCCTCTTGGCTGTGGAGC
TCCCATTTGAGGAAGAAAAGAGAAAGAATGCCGCCAAGGAAGAAGAACAGGAGGAAGAACCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGCGACGAAGAGATCGTGAACATGAGGGAGCCGGCCTATACTTTCGCCAGCATCTATGAGATCGATGTTAGGGACAAACACGGCCAAAAAGTTTCCATGAGTAAATACAGAGAC
AAGGTTCTTTTGATCGTCAATGTCGCCACAAAATC
GGCGTGTGCTTCAAGCATGTACAAGGAGCTCAACGAGCTCCACGTAAAATACGTGGACGAAGGGCTAGAGATTTTGGCATTCCCG
TGCAACCAATTCGCTGCGCAAGAGCCACTCAGGACGGAATATCTTCAAGAGACAGTCTCTTCTCGATTTGGGCCACACTTCCCACTCTTTGAAAGG
GTGGATGTAAATGGCCCAAACACC
GCAGTTCTCTTCAGGTACCTCAAGGACAAGAGCGATGGCGATCGAATTCGCTGGAATTTCACAAAGTTTTTGATCAATCGAACTGGTGGAATTGCTGGGAGATACGCCCCTCACATACCA
CCATACAAATTGGAG
GAAGATATCAAGAGCCTCTTGGCTGTGGAGCTCCCATTTGAGGAAGAAAAGAGAAAGAATGCCGCCAAGGAAGAAGAACAGGAGGAAGAACCCTAA

Retrieve as FASTA